CD1E Antibody

• CAS Number :

  9007-83-4

• Gene Name :

  CD1e molecule

• Gene Aliases :

  CD1A; CD1E antigen, e polypeptide; differentiation antigen CD1-alpha-3; hCD1e; leukocyte differentiation antigen; R2; R2G1; T-cell surface glycoprotein CD1e, membrane-associated; thymocyte antigen CD1E.

• Gene ID :

  913

• Swiss Prot :

  P15812

• Reactivity :

  Human|Mouse|Rat

• Immunogen :

  The antiserum was produced against synthesized peptide derived from the C-terminal region of human CD1E.

• Target :

  T-cell surface glycoprotein CD1e, soluble binds diacetylated lipids, including phosphatidyl inositides and diacylated sulfoglycolipids, and is required for the presentation of glycolipid antigens on the cell surface. The membrane-associated form is not active.

• Clonality :

  Polyclonal

• Type :

  Polyclonal Antibody

• Sequence :

  ILVVVDSRLKKQSSNKNILSPHTPSPVFLMGANTQDTKNSRHQFCLAQVS

• Applications :

  Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry-Paraffin|Western blot

• Purification :

  The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using peptide.

• Assay Protocol :

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Concentration :

  1mg/ml

• Reconstitution :

  -20°C

• Molecular Weight :

  43 kDa

• Specificity :

  CD1E Antibody detects endogenous levels of CD1E protein.

• NCBI Gene Symbol :

  CD1E

• Host or Source :

  Rabbit

• Protein Name :

  T-cell surface glycoprotein CD1e, membrane-associated

• Gene Name URL :

  CD1E