WAVE1 Antibody

• Gene Name:

  WASP family member 1

• Gene Aliases:

  Homology of dictyostelium scar 1; NEDALVS; protein WAVE-1; SCAR1; verprolin homology domain-containing protein 1; WAS protein family member 1; WASP family protein member 1; WAVE; WAVE1; wiskott-Aldrich syndrome protein family member 1.

• Gene ID:

  8936

• Swiss Prot:

  Q92558

• Reactivity:

  Human|Mouse|Rat

• Immunogen:

  The antiserum was produced against synthesized peptide derived from human WAVE1.

• Target:

  Downstream effector molecule involved in the transmission of signals from tyrosine kinase receptors and small GTPases to the actin cytoskeleton. Promotes formation of actin filaments. Part of the WAVE complex that regulates lamellipodia formation. The WAVE complex regulates actin filament reorganization via its interaction with the Arp2/3 complex (By similarity) . As component of the WAVE1 complex, required for BDNF-NTRK2 endocytic trafficking and signaling from early endosomes (By similarity) .

• Clonality:

  Polyclonal

• Type:

  Polyclonal Antibody

• Sequence:

  SLQDITMRKAFRSSTIQDQQLFDRKTLPIPLQETYDVCEQPPPLNILTPY

• Applications:

  Enzyme-linked immunosorbent assay|Immunocytochemistry|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot

• Purification:

  The antibody was purified from rabbit antiserum by affinity-chromatography using immunogen.

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Concentration:

  1mg/ml

• Format:

  Liquid// (without Mg2+ and Ca2+) (pH 7.4), 150mM NaCl, 0.02% sodium azide and 50% glycerol2+2+

• Reconstitution:

  -20°C

• Molecular Weight:

  61 kDa

• Notes:

  Formerly GWB-ASC272

• Fragment:

  IgG

• Specificity:

  WAVE1 Antibody detects endogenous levels of total WAVE1 protein.

• NCBI Gene Symbol:

  WASF1

• Host or Source:

  Rabbit

• Protein Name:

  Wiskott-Aldrich syndrome protein family member 1

• Gene Name URL:

  WASF1

• CAS Number:

  9007-83-4