Artemis Antibody

CAT:
247-OAAF07862-100UG
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Artemis Antibody - image 1

Artemis Antibody

  • Gene Name:

    DNA cross-link repair 1C
  • Gene Aliases:

    A-SCID; DCLREC1C; DNA cross-link repair 1C (PSO2 homolog, S. cerevisiae) ; DNA cross-link repair 1C protein; protein artemis; Protein A-SCID; RS-SCID; SCIDA; severe combined immunodeficiency, type a (Athabascan) ; SNM1 homolog C; SNM1C; SNM1-like protein.
  • Gene ID:

    64421
  • Swiss Prot:

    Q96SD1
  • Reactivity:

    Human|Mouse|Rat
  • Immunogen:

    The antiserum was produced against synthesized peptide derived from human Artemis.
  • Target:

    Required for V (D) J recombination, the process by which exons encoding the antigen-binding domains of immunoglobulins and T-cell receptor proteins are assembled from individual V, (D), and J gene segments. V (D) J recombination is initiated by the lymphoid specific RAG endonuclease complex, which generates site specific DNA double strand breaks (DSBs) . These DSBs present two types of DNA end structures: hairpin sealed coding ends and phosphorylated blunt signal ends. These ends are independently repaired by the non homologous end joining (NHEJ) pathway to form coding and signal joints respectively. This protein exhibits single-strand specific 5'-3' exonuclease activity in isolation and acquires endonucleolytic activity on 5' and 3' hairpins and overhangs when in a complex with PRKDC. The latter activity is required specifically for the resolution of closed hairpins prior to the formation of the coding joint. May also be required for the repair of complex DSBs induced by ionizing radiation, which require substantial end-processing prior to religation by NHEJ.
  • Clonality:

    Polyclonal
  • Type:

    Polyclonal Antibody
  • Sequence:

    ADGDVPQWEVFFKRNDEITDESLENFPSSTVAGGSQSPKLFSDSDGESTH
  • Applications:

    Enzyme-linked immunosorbent assay|Immunocytochemistry|Immunofluorescence|Immunohistochemistry-Paraffin
  • Purification:

    The antibody was purified from rabbit antiserum by affinity-chromatography using immunogen.
  • Assay Protocol:

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Concentration:

    1mg/ml
  • Reconstitution:

    -20°C
  • Molecular Weight:

    78 kDa
  • Notes:

    Formerly GWB-ASC162
  • Specificity:

    Artemis Antibody detects endogenous levels of total Artemis protein.
  • NCBI Gene Symbol:

    DCLRE1C
  • Host or Source:

    Rabbit
  • Protein Name:

    Protein artemis
  • Gene Name URL:

    DCLRE1C
  • CAS Number:

    9007-83-4