VHL Antibody (Phospho-Ser68)

• Gene Name:

  Von Hippel-Lindau tumor suppressor

• Gene Aliases:

  Elongin binding protein; HRCA1; protein G7; pVHL; RCA1; VHL1; von Hippel-Lindau disease tumor suppressor; von Hippel-Lindau tumor suppressor, E3 ubiquitin protein ligase.

• Gene ID:

  7428

• Swiss Prot:

  P40337

• Reactivity:

  Human|Mouse|Rat

• Immunogen:

  The antiserum was produced against synthesized peptide derived from human VHL around the phosphorylation site of Ser68.

• Target:

  Involved in the ubiquitination and subsequent proteasomal degradation via the von Hippel-Lindau ubiquitination complex. Seems to act as a target recruitment subunit in the E3 ubiquitin ligase complex and recruits hydroxylated hypoxia-inducible factor (HIF) under normoxic conditions. Involved in transcriptional repression through interaction with HIF1A, HIF1AN and histone deacetylases. Ubiquitinates, in an oxygen-responsive manner, ADRB2.

• Clonality:

  Polyclonal

• Type:

  Polyclonal Antibody

• Sequence:

  GAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRV

• Applications:

  Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot

• Purification:

  The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Concentration:

  1mg/ml

• Format:

  Liquid. Supplied in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.

• Reconstitution:

  -20°C

• Molecular Weight:

  24 kDa

• Specificity:

  VHL (Phospho-Ser68) Antibody detects endogenous levels of VHL only when phosphorylated at Ser68.

• NCBI Gene Symbol:

  VHL

• Host or Source:

  Rabbit

• Protein Name:

  Von Hippel-Lindau disease tumor suppressor

• Gene Name URL:

  VHL

• CAS Number:

  9007-83-4