MEF2A Antibody (Phospho-Thr312)

CAT:
247-OAAF07742-100UG
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
MEF2A Antibody (Phospho-Thr312) - image 1

MEF2A Antibody (Phospho-Thr312)

  • Gene Name:

    Myocyte enhancer factor 2A
  • Gene Aliases:

    ADCAD1; MADS box transcription enhancer factor 2, polypeptide A (myocyte enhancer factor 2A) ; mef2; myocyte-specific enhancer factor 2A; RSRFC4; RSRFC9; serum response factor-like protein 1.
  • Gene ID:

    4205
  • Swiss Prot:

    Q02078
  • Reactivity:

    Human|Mouse|Rat
  • Immunogen:

    The antiserum was produced against synthesized peptide derived from human MEF2A around the phosphorylation site of Thr312.
  • Target:

    Transcriptional activator which binds specifically to the MEF2 element, 5'-YTA[AT] (4) TAR-3', found in numerous muscle-specific genes. Also involved in the activation of numerous growth factor- and stress-induced genes. Mediates cellular functions not only in skeletal and cardiac muscle development, but also in neuronal differentiation and survival. Plays diverse roles in the control of cell growth, survival and apoptosis via p38 MAPK signaling in muscle-specific and/or growth factor-related transcription. In cerebellar granule neurons, phosphorylated and sumoylated MEF2A represses transcription of NUR77 promoting synaptic differentiation. Associates with chromatin to the ZNF16 promoter.
  • Clonality:

    Polyclonal
  • Type:

    Polyclonal Antibody
  • Sequence:

    PSSKGMMPPLSEEEELELNTQRISSSQATQPLATPVVSVTTPSLPPQGLV
  • Applications:

    Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Immunoprecipitation|Western blot
  • Purification:

    The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.
  • Assay Protocol:

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Concentration:

    1mg/ml
  • Reconstitution:

    -20°C
  • Molecular Weight:

    54 kDa
  • Notes:

    Formerly GWB-ASB731
  • Specificity:

    MEF2A (Phospho-Thr312) Antibody detects endogenous levels of MEF2A only when phosphorylated at Thr312.
  • NCBI Gene Symbol:

    MEF2A
  • Host or Source:

    Rabbit
  • Protein Name:

    Myocyte-specific enhancer factor 2A
  • Gene Name URL:

    MEF2A
  • CAS Number:

    9007-83-4