NIPA Antibody (Phospho-Ser354)

• Gene Name:

  Zinc finger C3HC-type containing 1

• Gene Aliases:

  Hematopoietic stem/progenitor cell protein 216; HSPC216; NIPA; nuclear interacting partner of anaplastic lymphoma kinase (ALK) ; nuclear-interacting partner of ALK; Nuclear-interacting partner of anaplastic lymphoma kinase; Zinc finger C3HC-type protein 1.

• Gene ID:

  51530

• Swiss Prot:

  Q86WB0

• Reactivity:

  Human|Monkey|Mouse|Rat

• Immunogen:

  The antiserum was produced against synthesized peptide derived from human NIPA around the phosphorylation site of Ser354.

• Target:

  Essential component of a SCF-type E3 ligase complex, SCF (NIPA), a complex that controls mitotic entry by mediating ubiquitination and subsequent degradation of cyclin B1 (CCNB1) . Its cell-cycle-dependent phosphorylation regulates the assembly of the SCF (NIPA) complex, restricting CCNB1 ubiquitination activity to interphase. Its inactivation results in nuclear accumulation of CCNB1 in interphase and premature mitotic entry. May have an antiapoptotic role in NPM-ALK-mediated signaling events.

• Clonality:

  Polyclonal

• Type:

  Polyclonal Antibody

• Sequence:

  ESPRRMMTRSQDATFSPGSEQAEKSPGPIVSRTRSWDSSSPVDRPEPEAA

• Applications:

  Enzyme-linked immunosorbent assay|Immunocytochemistry|Immunofluorescence|Western blot

• Purification:

  The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Concentration:

  1mg/ml

• Reconstitution:

  -20°C

• Molecular Weight:

  55 kDa

• Notes:

  Formerly GWB-ASB550

• Specificity:

  NIPA (Phospho-Ser354) Antibody detects endogenous levels of NIPA only when phosphorylated at Ser354.

• NCBI Gene Symbol:

  ZC3HC1

• Host or Source:

  Rabbit

• Protein Name:

  Nuclear-interacting partner of ALK

• Gene Name URL:

  ZC3HC1

• CAS Number:

  9007-83-4