Abl Antibody (Phospho-Tyr412)

• Gene Name:

  ABL proto-oncogene 1, non-receptor tyrosine kinase|ABL proto-oncogene 2, non-receptor tyrosine kinase

• Gene Aliases:

  Abelson murine leukemia viral oncogene homolog 1; Abelson murine leukemia viral oncogene homolog 2; Abelson tyrosine-protein kinase 1; Abelson tyrosine-protein kinase 2; abelson-related gene protein; ABL; ABL protooncogene 1 nonreceptor tyrosine kinase; ABLL; ARG; bcr/abl; bcr/c-abl oncogene protein; BCR-ABL; c-ABL; c-abl oncogene 1, receptor tyrosine kinase; c-abl oncogene 2, non-receptor tyrosine kinase; c-ABL1; CHDSKM; JTK7; p150; proto-oncogene c-Abl; proto-oncogene tyrosine-protein kinase ABL1; truncated ABL protooncogene 1 nonreceptor tyrosine kinase; tyrosine-protein kinase ABL1; tyrosine-protein kinase ABL2; tyrosine-protein kinase ARG; v-abl; v-abl Abelson murine leukemia viral oncogene homolog 1; v-abl Abelson murine leukemia viral oncogene homolog 2.

• Gene ID:

  25|27

• Swiss Prot:

  P00519|P42684

• Reactivity:

  Human|Monkey|Mouse

• Immunogen:

  The antiserum was produced against synthesized peptide derived from human Abl around the phosphorylation site of Tyr412.

• Target:

  Non-receptor tyrosine-protein kinase that plays a role in many key processes linked to cell growth and survival such as cytoskeleton remodeling in response to extracellular stimuli, cell motility and adhesion, receptor endocytosis, autophagy, DNA damage response and apoptosis. Coordinates actin remodeling through tyrosine phosphorylation of proteins controlling cytoskeleton dynamics like WASF3 (involved in branch formation) ; ANXA1 (involved in membrane anchoring) ; DBN1, DBNL, CTTN, RAPH1 and ENAH (involved in signaling) ; or MAPT and PXN (microtubule-binding proteins) . Phosphorylation of WASF3 is critical for the stimulation of lamellipodia formation and cell migration. Involved in the regulation of cell adhesion and motility through phosphorylation of key regulators of these processes such as BCAR1, CRK, CRKL, DOK1, EFS or NEDD9. Phosphorylates multiple receptor tyrosine kinases and more particularly promotes endocytosis of EGFR, facilitates the formation of neuromuscular synapses through MUSK, inhibits PDGFRB-mediated chemotaxis and modulates the endocytosis of activated B-cell receptor complexes. Other substrates which are involved in endocytosis regulation are the caveolin (CAV1) and RIN1. Moreover, ABL1 regulates the CBL family of ubiquitin ligases that drive receptor down-regulation and actin remodeling. Phosphorylation of CBL leads to increased EGFR stability. Involved in late-stage autophagy by regulating positively the trafficking and function of lysosomal components. ABL1 targets to mitochondria in response to oxidative stress and thereby mediates mitochondrial dysfunction and cell death. In response to oxidative stress, phosphorylates serine/threonine kinase PRKD2 at 'Tyr-717' (PubMed:28428613) . ABL1 is also translocated in the nucleus where it has DNA-binding activity and is involved in DNA-damage response and apoptosis. Many substrates are known mediators of DNA repair: DDB1, DDB2, ERCC3, ERCC6, RAD9A, RAD51, RAD52 or WRN. Activates the proapoptotic pathway when the DNA damage is too severe to be repaired. Phosphorylates TP73, a primary regulator for this type of damage-induced apoptosis. Phosphorylates the caspase CASP9 on 'Tyr-153' and regulates its processing in the apoptotic response to DNA damage. Phosphorylates PSMA7 that leads to an inhibition of proteasomal activity and cell cycle transition blocks. ABL1 acts also as a regulator of multiple pathological signaling cascades during infection. Several known tyrosine-phosphorylated microbial proteins have been identified as ABL1 substrates. This is the case of A36R of Vaccinia virus, Tir (translocated intimin receptor) of pathogenic E.coli and possibly Citrobacter, CagA (cytotoxin-associated gene A) of H.pylori, or AnkA (ankyrin repeat-containing protein A) of A.phagocytophilum. Pathogens can highjack ABL1 kinase signaling to reorganize the host actin cytoskeleton for multiple purposes, like facilitating intracellular movement and host cell exit. Finally, functions as its own regulator through autocatalytic activity as well as through phosphorylation of its inhibitor, ABI1. Regulates T-cell differentiation in a TBX21-dependent manner. Phosphorylates TBX21 on tyrosine residues leading to an enhancement of its transcriptional activator activity (By similarity) .|Non-receptor tyrosine-protein kinase that plays an ABL1-overlapping role in key processes linked to cell growth and survival such as cytoskeleton remodeling in response to extracellular stimuli, cell motility and adhesion and receptor endocytosis. Coordinates actin remodeling through tyrosine phosphorylation of proteins controlling cytoskeleton dynamics like MYH10 (involved in movement) ; CTTN (involved in signaling) ; or TUBA1 and TUBB (microtubule subunits) . Binds directly F-actin and regulates actin cytoskeletal structure through its F-actin-bundling activity. Involved in the regulation of cell adhesion and motility through phosphorylation of key regulators of these processes such as CRK, CRKL, DOK1 or ARHGAP35. Adhesion-dependent phosphorylation of ARHGAP35 promotes its association with RASA1, resulting in recruitment of ARHGAP35 to the cell periphery where it inhibits RHO. Phosphorylates multiple receptor tyrosine kinases like PDGFRB and other substrates which are involved in endocytosis regulation such as RIN1. In brain, may regulate neurotransmission by phosphorylating proteins at the synapse. ABL2 acts also as a regulator of multiple pathological signaling cascades during infection. Pathogens can highjack ABL2 kinase signaling to reorganize the host actin cytoskeleton for multiple purposes, like facilitating intracellular movement and host cell exit. Finally, functions as its own regulator through autocatalytic activity as well as through phosphorylation of its inhibitor, ABI1.

• Clonality:

  Polyclonal

• Type:

  Polyclonal Antibody

• Sequence:

  HRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPES

• Applications:

  Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot

• Purification:

  The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Concentration:

  1 mg/ml

• Format:

  Liquid// PBS (without Mg2+ and Ca2+) pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol

• Reconstitution:

  -20°C

• Molecular Weight:

  122 kDa

• Notes:

  Formerly GWB-ASB083

• Fragment:

  IgG

• Specificity:

  Abl (Phospho-Tyr412) Antibody detects endogenous levels of Abl only when phosphorylated at Tyr412.

• NCBI Gene Symbol:

  ABL1|ABL2

• Host or Source:

  Rabbit

• Protein Name:

  Tyrosine-protein kinase ABL1|Tyrosine-protein kinase ABL2

• Gene Name URL:

  ABL1|ABL2

• CAS Number:

  9007-83-4