Goat anti-CD9 Polyclonal antibody

• Description:

  CD9 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. This protein functions in many cellular processes including differentiation, adhesion, and signal transduction, playing a critical role in the suppression of cancer cell motility and metastasis.

• Specifications:

  Reacts with CD9 detected by Western blot using the following human (Jurkat, MCF7, HeLa, HEK-293), mouse (NIH3T3) whole cell lysates.

• Product Name Alternative:

  5H9 Antigen, BA2, BA-2/P24 Antigen 3, BTCC-1, Cell Growth-Inhibiting Gene 2 Protein, CD9 antigen, CD9 Molecule, DRAP-27, Leukocyte Antigen MIC3, MIC3, Motility Related Protein-1, Motility-Related Protein 4, MRP-1, P24, Tetraspanin-29, TSPAN29 antibody.

• Volume:

  100 µL

• Gene ID:

  ENSG00000010278, Gene ID: 928

• Accession Number:

  ENSG00000010278

• Host:

  Goat

• Antigen Species:

  Human

• Reactivity:

  Reacts against human, rat, mouse, canine and monkey proteins.

• Immunogen:

  Purified recombinant peptide derived from within residues 115 aa to 195 aa of human CD9 produced in E. coli.

• Target Antigen:

  Purified recombinant peptide derived from within residues 115 aa to 195 aa of human CD9 produced in E. coli.

• Immunogen Type:

  Recombinant protein

• Target:

  Anti-CD9

• Clonality:

  Polyclonal

• Isotype:

  IgG

• Conjugation:

  Unconjugated

• Type:

  Primary

• Sequence:

  HKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKF

• Applications:

  WB

• Purification:

  Epitope affinity purified

• Concentration:

  3 mg/mL

• Dilution:

  WB:1:1,000-1:2,000

• Form:

  Polyclonal antibody supplied as a 100 µl (3 mg/mL) aliquot in PBS, 20% glycerol and 0.05% sodium azide.

• Buffer:

  PBS, 20% glycerol and 0.05% sodium azide

• Storage Conditions:

  For continuous use, store at 2-8 C for one-two days. For extended storage, store in -20 C freezer. Working dilution samples should be discarded if not used within 12 hours.

• CAS Number:

  9007-83-4