Anti-Dclk3

• Gene Name :

  Doublecortin-like kinase 3

• Gene Aliases :

  Dcamk, Dcamkl3, BC056929, C730036H08

• Gene ID :

  245038

• Swiss Prot :

  Q8BWQ5

• Accession Number :

  NP_766516.2

• Reactivity :

  Mouse

• Immunogen :

  The immunogen is a synthetic peptide directed towards the C terminal region of mouse DCLK3

• Target :

  This gene encodes a member of the protein kinase superfamily and the doublecortin family. Differently from the other two closely related family members (DCLK1 and DCLK2), the protein encoded by this gene contains only one N-terminal doublecortin domain and is unable to bind microtubules and to regulate microtubule polymerization. The protein contains a C-terminal serine/threonine protein kinase domain, which shows substantial homology to Ca2+/calmoduline-dependent protein kinase, and a serine/proline-rich domain in between the doublecortin and the protein kinase domains, which mediates multiple protein-protein interactions.

• Clonality :

  Polyclonal

• Type :

  Polyclonal Antibody

• Sequence :

  MWAAGVILYILLCGFPPFRSPERDQDELFNIIQVGQFEFLSPYWDNISDA

• Applications :

  WB

• Purification :

  Affinity purified

• Assay Protocol :

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Concentration :

  0.5 mg/ml

• Format :

  Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

• Reconstitution :

  For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

• Molecular Weight :

  86 kDa

• Protein Length :

  790

• NCBI Gene Symbol :

  DCLK3

• Host or Source :

  Rabbit

• Protein Name :

  Serine/threonine-protein kinase DCLK3

• Gene Name URL :

  DCLK3

• CAS Number :

  9007-83-4

• Nucleotide Accession Number :

  NM_172928.5