THRA Antibody - N-terminal region

• Gene Name:

  Thyroid hormone receptor alpha

• Gene Aliases:

  Er, Nr, Rvr, T3R, Thr, Erba, T3R[, Nr1a1, Thra1, Thra2, c-erb, T3R[a], AW259572, T3Ralpha, c-erbA-1, c-erbAalpha, c-erbA-alpha, 6430529J03Rik

• Gene ID:

  21833

• Swiss Prot:

  P63058

• Accession Number:

  NP_001300912.1

• Reactivity:

  Mouse

• Immunogen:

  The immunogen is a synthetic peptide directed towards the N terminal region of mouse THRA

• Target:

  The protein encoded by this gene is one of several nuclear hormone receptors that bind thyroid hormones such as triiodothyronine and thyroxine with high affinity. The encoded protein is a transcription factor that can activate or repress transcription. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.

• Clonality:

  Polyclonal

• Type:

  Polyclonal Antibody

• Sequence:

  NSARSPDGKRKRKNGQCPLKSSMSGYIPSYLDKDEQCVVCGDKATGYHYR

• Applications:

  WB

• Purification:

  Affinity purified

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Concentration:

  0.5 mg/ml

• Format:

  Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

• Reconstitution:

  For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

• Molecular Weight:

  54 kDa

• Protein Length:

  492

• NCBI Gene Symbol:

  THRA

• Host or Source:

  Rabbit

• Protein Name:

  Thyroid hormone receptor alpha

• Gene Name URL:

  THRA

• CAS Number:

  9007-83-4

• Nucleotide Accession Number:

  NM_001313983.1