STRAP Antibody - middle region

CAT:
247-ARP88952_P050-25UL
Size:
25 µL
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
STRAP Antibody - middle region - image 1

STRAP Antibody - middle region

  • CAS Number :

    9007-83-4
  • Gene Name :

    Serine/threonine kinase receptor associated protein
  • Gene Aliases :

    U, Unrip, C78091, C79202, AW557906
  • Gene ID :

    20901
  • Swiss Prot :

    Q9Z1Z2
  • Accession Number :

    NP_035629.2
  • Reactivity :

    Mouse
  • Immunogen :

    The immunogen is a synthetic peptide directed towards the middle region of mouse STRAP
  • Target :

    The SMN complex plays a catalyst role in the assembly of small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome. Thereby, plays an important role in the splicing of cellular pre-mRNAs. Most spliceosomal snRNPs contain a common set of Sm proteins SNRPB, SNRPD1, SNRPD2, SNRPD3, SNRPE, SNRPF and SNRPG that assemble in a heptameric protein ring on the Sm site of the small nuclear RNA to form the core snRNP. In the cytosol, the Sm proteins SNRPD1, SNRPD2, SNRPE, SNRPF and SNRPG are trapped in an inactive 6S pICln-Sm complex by the chaperone CLNS1A that controls the assembly of the core snRNP. Dissociation by the SMN complex of CLNS1A from the trapped Sm proteins and their transfer to an SMN-Sm complex triggers the assembly of core snRNPs and their transport to the nucleus. STRAP plays a role in the cellular distribution of the SMN complex. Negatively regulates TGF-beta signaling but positively regulates the PDPK1 kinase activity by enhancing its autophosphorylation and by significantly reducing the association of PDPK1 with 14-3-3 protein (By similarity) .
  • Clonality :

    Polyclonal
  • Type :

    Polyclonal Antibody
  • Sequence :

    KLYKYDYNSGEELESYKGHFGPIHCVRFSPDGELYASGSEDGTLRLWQTV
  • Applications :

    WB
  • Purification :

    Affinity purified
  • Assay Protocol :

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Concentration :

    0.5 mg/ml
  • Format :

    Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  • Reconstitution :

    For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
  • Molecular Weight :

    38 kDa
  • Protein Length :

    350
  • NCBI Gene Symbol :

    STRAP
  • Host or Source :

    Rabbit
  • Protein Name :

    Serine-threonine kinase receptor-associated protein
  • Gene Name URL :

    STRAP
  • Nucleotide Accession Number :

    NM_011499.3

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide