SLC25A3 Antibody - C-terminal region

• Gene Name:

  Solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 3

• Gene Aliases:

  PHC, PTP, OK/SW-cl.48

• Gene ID:

  5250

• Swiss Prot:

  Q00325

• Accession Number:

  NP_002626.1

• Reactivity:

  Human

• Immunogen:

  The immunogen is a synthetic peptide directed towards the C terminal region of human SLC25A3

• Target:

  The protein encoded by this gene catalyzes the transport of phosphate into the mitochondrial matrix, either by proton cotransport or in exchange for hydroxyl ions. The protein contains three related segments arranged in tandem which are related to those found in other characterized members of the mitochondrial carrier family. Both the N-terminal and C-terminal regions of this protein protrude toward the cytosol. Multiple alternatively spliced transcript variants have been isolated.

• Clonality:

  Polyclonal

• Type:

  Polyclonal Antibody

• Sequence:

  FKGVWKGLFARIIMIGTLTALQWFIYDSVKVYFRLPRPPPPEMPESLKKK

• Applications:

  WB

• Purification:

  Affinity purified

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Concentration:

  0.5 mg/ml

• Format:

  Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

• Reconstitution:

  For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

• Molecular Weight:

  39 kDa

• Protein Length:

  362

• NCBI Gene Symbol:

  SLC25A3

• Host or Source:

  Rabbit

• Protein Name:

  Phosphate carrier protein, mitochondrial

• Gene Name URL:

  SLC25A3

• CAS Number:

  9007-83-4

• Nucleotide Accession Number:

  NM_002635.3