GIT2 Antibody - middle region

CAT:
247-ARP84867_P050-25UL
Size:
25 µL
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
GIT2 Antibody - middle region - image 1

GIT2 Antibody - middle region

  • CAS Number :

    9007-83-4
  • Gene Name :

    G protein-coupled receptor kinase interacting ArfGAP 2
  • Gene Aliases :

    PKL, CAT2, CAT-2
  • Gene ID :

    9815
  • Swiss Prot :

    Q14161
  • Accession Number :

    NP_001128685.1
  • Reactivity :

    Human
  • Immunogen :

    The immunogen is a synthetic peptide directed towards the middle region of human GIT2
  • Target :

    This gene encodes a member of the GIT protein family, which interact with G protein-coupled receptor kinases and possess ADP-ribosylation factor (ARF) GTPase-activating protein (GAP) activity. GIT proteins traffic between cytoplasmic complexes, focal adhesions, and the cell periphery, and interact with Pak interacting exchange factor beta (PIX) to form large oligomeric complexes that transiently recruit other proteins. GIT proteins regulate cytoskeletal dynamics and participate in receptor internalization and membrane trafficking. This gene has been shown to repress lamellipodial extension and focal adhesion turnover, and is thought to regulate cell motility. This gene undergoes extensive alternative splicing to generate multiple isoforms, but the full-length nature of some of these variants has not been determined. The various isoforms have functional differences, with respect to ARF GAP activity and to G protein-coupled receptor kinase 2 binding.
  • Clonality :

    Polyclonal
  • Type :

    Polyclonal Antibody
  • Sequence :

    VELILKTINNQHSVESQDNDQPDYDSVASDEDTDLETTASKTNRQKSLDS
  • Applications :

    WB
  • Purification :

    Affinity purified
  • Assay Protocol :

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Concentration :

    0.5 mg/ml
  • Format :

    Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  • Reconstitution :

    For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
  • Molecular Weight :

    83 kDa
  • Protein Length :

    759
  • NCBI Gene Symbol :

    GIT2
  • Host or Source :

    Rabbit
  • Protein Name :

    ARF GTPase-activating protein GIT2
  • Gene Name URL :

    GIT2
  • Nucleotide Accession Number :

    NM_001135213.1

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide