EEF1D Antibody - middle region

• Gene Name :

  Eukaryotic translation elongation factor 1 delta

• Gene Aliases :

  EF1D, EF-1D, FP1047

• Gene ID :

  1936

• Swiss Prot :

  P29692

• Accession Number :

  NP_001123525.2

• Reactivity :

  Human

• Immunogen :

  The immunogen is a synthetic peptide directed towards the middle region of human EEF1D

• Target :

  This gene encodes a subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This subunit, delta, functions as guanine nucleotide exchange factor. It is reported that following HIV-1 infection, this subunit interacts with HIV-1 Tat. This interaction results in repression of translation of host cell proteins and enhanced translation of viral proteins. Several alternatively spliced transcript variants encoding multiple isoforms have been found for this gene. Related pseudogenes have been defined on chromosomes 1, 6, 7, 9, 11, 13, 17, 19.

• Clonality :

  Polyclonal

• Type :

  Polyclonal Antibody

• Sequence :

  TAPQTQHVSPMRQVEPPAKKPATPAEDDEDDDIDLFGSDNEEEDKEAAQL

• Applications :

  WB

• Purification :

  Affinity purified

• Assay Protocol :

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Concentration :

  0.5 mg/ml

• Format :

  Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

• Reconstitution :

  For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

• Molecular Weight :

  30 kDa

• Protein Length :

  281

• NCBI Gene Symbol :

  EEF1D

• Host or Source :

  Rabbit

• Protein Name :

  Elongation factor 1-delta

• Gene Name URL :

  EEF1D

• CAS Number :

  9007-83-4

• Nucleotide Accession Number :

  NM_001130053.2