ASIC2 Antibody - C-terminal region

CAT:
247-ARP79164_P050-25UL
Size:
25 µL
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
ASIC2 Antibody - C-terminal region - image 1

ASIC2 Antibody - C-terminal region

  • Gene Name:

    Acid sensing ion channel subunit 2
  • Gene Aliases:

    ACCN, BNC1, MDEG, ACCN1, BNaC1, ASIC2a, hBNaC1
  • Gene ID:

    40
  • Swiss Prot:

    Q16515
  • Accession Number:

    NP_001085.2
  • Reactivity:

    Human
  • Immunogen:

    The immunogen is a synthetic peptide directed towards the C terminal region of human ACCN1
  • Target:

    This gene encodes a member of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily. The members of this family are amiloride-sensitive sodium channels that contain intracellular N and C termini, 2 hydrophobic transmembrane regions, and a large extracellular loop, which has many cysteine residues with conserved spacing. The member encoded by this gene may play a role in neurotransmission. In addition, a heteromeric association between this member and acid-sensing (proton-gated) ion channel 3 has been observed to co-assemble into proton-gated channels sensitive to gadolinium. Alternative splicing has been observed at this locus and two variants, encoding distinct isoforms, have been identified.
  • Clonality:

    Polyclonal
  • Type:

    Polyclonal Antibody
  • Sequence:

    GASILTILELFDYIYELIKEKLLDLLGKEEDEGSHDENVSTCDTMPNHSE
  • Applications:

    WB
  • Purification:

    Affinity purified
  • Assay Protocol:

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Concentration:

    0.5 mg/ml
  • Format:

    Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  • Reconstitution:

    For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
  • Molecular Weight:

    56 kDa
  • Protein Length:

    512
  • NCBI Gene Symbol:

    ASIC2
  • Host or Source:

    Rabbit
  • Protein Name:

    Acid-sensing ion channel 2
  • Gene Name URL:

    ASIC2
  • CAS Number:

    9007-83-4
  • Nucleotide Accession Number:

    NM_001094.4