APOBEC3C Antibody - C-terminal region (ARP78324_P050)

• Gene Name:

  Apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3C

• Gene Aliases:

  A3C, PBI, ARP5, ARDC2, ARDC4, APOBEC1L, bK150C2.3

• Gene ID:

  27350

• Swiss Prot:

  Q9NRW3

• Accession Number:

  NP_055323.2

• Reactivity:

  Human

• Immunogen:

  The immunogen is a synthetic peptide directed towards the C terminal region of human APOBEC3C

• Target:

  This gene is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. It is thought that the proteins may be RNA editing enzymes and have roles in growth or cell cycle control.

• Clonality:

  Polyclonal

• Type:

  Polyclonal Antibody

• Sequence:

  EGLRSLSQEGVAVEIMDYEDFKYCWENFVYNDNEPFKPWKGLKTNFRLLK

• Applications:

  WB

• Purification:

  Affinity purified

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Concentration:

  0.5 mg/ml

• Format:

  Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

• Reconstitution:

  For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

• Molecular Weight:

  23 kDa

• Protein Length:

  190

• NCBI Gene Symbol:

  APOBEC3C

• Host or Source:

  Rabbit

• Protein Name:

  DNA dC->dU-editing enzyme APOBEC-3C

• Gene Name URL:

  APOBEC3C

• CAS Number:

  9007-83-4

• Nucleotide Accession Number:

  NM_014508.2