ATP6AP2 Antibody - middle region (ARP78211_P050)

CAT:
247-ARP78211_P050
Size:
100 µL
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
ATP6AP2 Antibody - middle region (ARP78211_P050) - image 1

ATP6AP2 Antibody - middle region (ARP78211_P050)

  • Gene Name:

    ATPase H+ transporting accessory protein 2
  • Gene Aliases:

    PRR, M8-9, MRXE, RENR, XMRE, XPDS, CDG2R, HT028, MRXSH, ELDF10, ATP6IP2, MSTP009, APT6M8-9, ATP6M8-9
  • Gene ID:

    10159
  • Swiss Prot:

    H0Y750
  • Accession Number:

    NP_005756.2
  • Reactivity:

    Human
  • Immunogen:

    The immunogen is a synthetic peptide directed towards the middle region of human ATP6AP2
  • Target:

    This gene encodes a protein that is associated with adenosine triphosphatases (ATPases) . Proton-translocating ATPases have fundamental roles in energy conservation, secondary active transport, acidification of intracellular compartments, and cellular pH homeostasis. There are three classes of ATPases- F, P, and V. The vacuolar (V-type) ATPases have a transmembrane proton-conducting sector and an extramembrane catalytic sector. The encoded protein has been found associated with the transmembrane sector of the V-type ATPases.
  • Clonality:

    Polyclonal
  • Type:

    Polyclonal Antibody
  • Sequence:

    AKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYS
  • Applications:

    WB
  • Purification:

    Affinity purified
  • Assay Protocol:

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Concentration:

    0.5 mg/ml
  • Format:

    Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  • Reconstitution:

    For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
  • Molecular Weight:

    26 kDa
  • Protein Length:

    243
  • NCBI Gene Symbol:

    ATP6AP2
  • Host or Source:

    Rabbit
  • Protein Name:

    Renin receptor
  • Gene Name URL:

    ATP6AP2
  • CAS Number:

    9007-83-4