SPSB1 Antibody - middle region

CAT:
247-ARP66688_P050-25UL
Size:
25 µL
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
SPSB1 Antibody - middle region - image 1

SPSB1 Antibody - middle region

  • Gene Aliases:

    SSB1, SSB-1
  • Gene ID:

    80176
  • Swiss Prot:

    Q96BD6
  • Accession Number:

    NP_079382
  • Reactivity:

    Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
  • Immunogen:

    The immunogen is a synthetic peptide directed towards the middle region of Human SPSB1
  • Target:

    SPSB1 is a probable substrate recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.
  • Partner Proteins:

    PRMT6; KDM1A; SUV39H1; PRMT1; NOS2; HSP90AA1; ATM; TCEB2; TCEB1; RNF7; CUL5; Pawr; Ddx4; RASA1; MET; ELAVL1; UBC; TP73; TP53
  • Clonality:

    Polyclonal
  • Type:

    Polyclonal Antibody
  • Sequence:

    RGLHVWQITWAMRQRGTHAVVGVATADAPLHSVGYTTLVGNNHESWGWDL
  • Applications:

    WB
  • Purification:

    Affinity Purified
  • Assay Protocol:

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Concentration:

    0.5 mg/ml
  • Homology:

    Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
  • Format:

    Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  • Reconstitution:

    For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
  • Molecular Weight:

    31 kDa
  • Protein Length:

    273
  • NCBI Gene Symbol:

    SPSB1
  • Host or Source:

    Rabbit
  • Protein Name:

    SPRY domain-containing SOCS box protein 1
  • Gene Name URL:

    SPSB1
  • CAS Number:

    9007-83-4
  • Nucleotide Accession Number:

    NM_025106