SPSB1 Antibody - middle region

• Gene Aliases:

  SSB1, SSB-1

• Gene ID:

  80176

• Swiss Prot:

  Q96BD6

• Accession Number:

  NP_079382

• Reactivity:

  Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish

• Immunogen:

  The immunogen is a synthetic peptide directed towards the middle region of Human SPSB1

• Target:

  SPSB1 is a probable substrate recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.

• Partner Proteins:

  PRMT6; KDM1A; SUV39H1; PRMT1; NOS2; HSP90AA1; ATM; TCEB2; TCEB1; RNF7; CUL5; Pawr; Ddx4; RASA1; MET; ELAVL1; UBC; TP73; TP53

• Clonality:

  Polyclonal

• Type:

  Polyclonal Antibody

• Sequence:

  RGLHVWQITWAMRQRGTHAVVGVATADAPLHSVGYTTLVGNNHESWGWDL

• Applications:

  WB

• Purification:

  Affinity Purified

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Concentration:

  0.5 mg/ml

• Homology:

  Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%

• Format:

  Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

• Reconstitution:

  For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

• Molecular Weight:

  31 kDa

• Protein Length:

  273

• NCBI Gene Symbol:

  SPSB1

• Host or Source:

  Rabbit

• Protein Name:

  SPRY domain-containing SOCS box protein 1

• Gene Name URL:

  SPSB1

• CAS Number:

  9007-83-4

• Nucleotide Accession Number:

  NM_025106