P2RY13 Antibody - C-terminal region

• Description:

  Click here to learn more about Aviva's By-Request Conjugation Service.//here

• Gene Name:

  Purinergic receptor P2Y, G-protein coupled, 13

• Gene Aliases:

  GPCR1, GPR86, GPR94, P2Y13, SP174, FKSG77

• Gene ID:

  53829

• Swiss Prot:

  Q9BPV8

• Accession Number:

  NP_795713

• Reactivity:

  Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit

• Immunogen:

  The immunogen is a synthetic peptide directed towards the C-terminal region of Human P2RY13

• Target:

  The product of this gene belongs to the family of G-protein coupled receptors. This family has several receptor subtypes with different pharmacological selectivity, which overlaps in some cases, for various adenosine and uridine nucleotides. This receptor is activated by ADP.

• Clonality:

  Polyclonal

• Type:

  Polyclonal Antibody

• Sequence:

  YTHSQTNNKTDCRLQNQLFIAKETTLFLAATNICMDPLIYIFLCKKFTEK

• Applications:

  WB

• Purification:

  Affinity Purified

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Concentration:

  0.5 mg/ml

• Homology:

  Cow: 93%; Dog: 86%; Guinea Pig: 92%; Horse: 77%; Human: 100%; Mouse: 86%; Rabbit: 79%; Rat: 93%

• Format:

  Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

• Reconstitution:

  For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

• Molecular Weight:

  41kDa

• Protein Length:

  354

• NCBI Gene Symbol:

  P2RY13

• Host or Source:

  Rabbit

• Protein Name:

  P2Y purinoceptor 13

• Gene Name URL:

  P2RY13

• CAS Number:

  9007-83-4

• Nucleotide Accession Number:

  NM_176894