ADM2 Antibody

• Description:

  Click here to learn more about Aviva's By-Request Conjugation Service.//here

• Gene Name:

  Adrenomedullin 2

• Gene Aliases:

  AM2, dJ579N16.4

• Gene ID:

  79924

• Swiss Prot:

  Q7Z4H4

• Accession Number:

  NP_079142

• Reactivity:

  Human, Mouse, Rat, Cow, Horse, Pig

• Immunogen:

  The immunogen is a synthetic peptide directed towards the following sequence GPRRTQAQLLRVGCVLGTCQVQNLSHRLWQLMGPAGRQDSAPVDPSSPHS

• Target:

  This gene encodes a protein which is a member of the calcitonin-related hormones. The encoded protein is involved in maintaining homeostasis in many tissues, acting via CRLR/RAMP receptor (calcitonin receptor-like receptor/receptor activity-modifying protein) complexes. Multiple alternatively spliced variants, encoding the same protein, have been identified.

• Clonality:

  Polyclonal

• Type:

  Polyclonal Antibody

• Sequence:

  GPRRTQAQLLRVGCVLGTCQVQNLSHRLWQLMGPAGRQDSAPVDPSSPHS

• Applications:

  IHC

• Purification:

  Affinity Purified

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Concentration:

  0.5 mg/ml

• Homology:

  Cow: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 83%; Rat: 93%

• Format:

  Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

• Reconstitution:

  For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

• Molecular Weight:

  16 kDa

• Protein Length:

  148

• NCBI Gene Symbol:

  ADM2

• Host or Source:

  Rabbit

• Protein Name:

  ADM2

• Gene Name URL:

  ADM2

• CAS Number:

  9007-83-4

• Nucleotide Accession Number:

  NM_001253845