CDK5RAP3 Antibody - C-terminal region

• Gene Name:

  CDK5 regulatory subunit associated protein 3

• Gene Aliases:

  C53, IC53, LZAP, HSF-27, MST016, PP1553, OK/SW-cl.114

• Gene ID:

  80279

• Swiss Prot:

  F5H3I5

• Accession Number:

  NP_001265126.1

• Reactivity:

  Human

• Immunogen:

  The immunogen is a synthetic peptide directed towards the C-terminal region of human CDK5RAP3

• Target:

  This gene encodes a protein that has been reported to function in signaling pathways governing transcriptional regulation and cell cycle progression. It may play a role in tumorigenesis and metastasis. A pseudogene of this gene is located on the long arm of chromosome 20. Alternative splicing results in multiple transcript variants that encode different isoforms.

• Clonality:

  Polyclonal

• Type:

  Polyclonal Antibody

• Sequence:

  IDWGDFGVEAVSEGTDSGISAEAAGIDWGIFPESDSKDPGGDGIDWGDDA

• Applications:

  WB

• Purification:

  Affinity Purified

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Concentration:

  0.5 mg/ml

• Homology:

  Human: 100%

• Format:

  Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

• Reconstitution:

  For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

• Molecular Weight:

  57 kDa

• Protein Length:

  531

• NCBI Gene Symbol:

  CDK5RAP3

• Host or Source:

  Rabbit

• Protein Name:

  CDK5 regulatory subunit-associated protein 3

• Gene Name URL:

  CDK5RAP3

• CAS Number:

  9007-83-4

• Nucleotide Accession Number:

  NM_001278197.1