PIGC Antibody - C-terminal region

CAT:
247-ARP60841_P050-25UL
Size:
25 µL
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
PIGC Antibody - C-terminal region - image 1

PIGC Antibody - C-terminal region

  • Description:

    Click here to learn more about Aviva's By-Request Conjugation Service.//here
  • Gene Name:

    Phosphatidylinositol glycan anchor biosynthesis, class C
  • Gene Aliases:

    GPI2, MRT62, GPIBD16
  • Gene ID:

    5279
  • Swiss Prot:

    Q92535
  • Accession Number:

    NP_002633
  • Reactivity:

    Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
  • Immunogen:

    The immunogen is a synthetic peptide directed towards the C terminal region of human PIGC
  • Target:

    This gene encodes an endoplasmic reticulum associated protein that is involved in glycosylphosphatidylinositol (GPI) lipid anchor biosynthesis. The GPI lipid anchor is a glycolipid found on many blood cells and serves to anchor proteins to the cell surface. The encoded protein is one subunit of the GPI N-acetylglucosaminyl (GlcNAc) transferase that transfers GlcNAc to phosphatidylinositol (PI) on the cytoplasmic side of the endoplasmic reticulum.
  • Partner Proteins:

    KLF10; DPM2; ZHX1; PIGQ
  • Clonality:

    Polyclonal
  • Type:

    Polyclonal Antibody
  • Sequence:

    AVGAVLFALLLMSISCLCPFYLIRLQLFKENIHGPWDEAEIKEDLSRFLS
  • Applications:

    WB
  • Purification:

    Affinity Purified
  • Assay Protocol:

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Concentration:

    0.5 mg/ml
  • Homology:

    Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
  • Format:

    Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  • Reconstitution:

    For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
  • Molecular Weight:

    33kDa
  • Protein Length:

    297
  • NCBI Gene Symbol:

    PIGC
  • Host or Source:

    Rabbit
  • Protein Name:

    Phosphatidylinositol N-acetylglucosaminyltransferase subunit C
  • Gene Name URL:

    PIGC
  • CAS Number:

    9007-83-4
  • Nucleotide Accession Number:

    NM_002642