Recombinant Macaca fascicularis Myoglobin (MB)

Recombinant Macaca fascicularis Myoglobin (MB)

• CAS Number: 9000-83-3
• Gene Name: MB
• UniProt: P02150
• Expression Region: 2-154aa
• Organism: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
• Target Sequence: GLSDGEWQLVLNVWGKVEADIPSHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGVTVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLELISESIIQVLQSKHPGDFGADAQGAMNKALELFRNDMAAKYKELGFQG
• Tag: C-terminal 6xHis-tagged
• Source: E.coli
• Field of Research: Others
• Assay Type: In Stock Protein
• Relevance: Serves as a reserve supply of oxygen and facilitates the movement of oxygen within muscles.
• Purity: Greater than 90% as determined by SDS-PAGE.
• Activity: Not Test
• Length: Full Length of Mature Protein
• Form: Liquid or Lyophilized powder
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Molecular Weight: 23.9 kDa
• References & Citations: "The myoglobin of primates. 3. Cercopithecidae (Old World monkeys): Papio anubis (olive baboon) and Macaca fascicularis (=irus, crab-eating monkey)." Romero-Herrera A.E., Lehmann H. Biochim. Biophys. Acta 278:465-481 (1972)
• Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.