MAS1

CAT:
247-ARP51196_T100
Size:
100 µL
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
MAS1 - image 1

MAS1

  • Gene Name:

    MAS1 oncogene
  • Gene Aliases:

    MAS, MGRA
  • Gene ID:

    4142
  • Swiss Prot:

    P04201
  • Accession Number:

    NP_002368
  • Reactivity:

    Human, Mouse, Rat, Guinea Pig
  • Immunogen:

    The immunogen is a synthetic peptide directed towards the middle region of human MAS1
  • Target:

    The structure of MAS1 indicates that it belongs to the class of receptors that are coupled to GTP-binding proteins and share a conserved structural motif, which is described as a '7-transmembrane segment' following the prediction that these hydrophobic segments form membrane-spanning alpha-helices. The MAS1 protein may be a receptor that, when activated, modulates a critical component in a growth-regulating pathway to bring about oncogenic effects.The structure of the MAS1 product indicates that it belongs to the class of receptors that are coupled to GTP-binding proteins and share a conserved structural motif, which is described as a '7-transmembrane segment' following the prediction that these hydrophobic segments form membrane-spanning alpha-helices. The MAS1 protein may be a receptor that, when activated, modulates a critical component in a growth-regulating pathway to bring about oncogenic effects.
  • Partner Proteins:

    SNTA1; AGT
  • Clonality:

    Polyclonal
  • Type:

    Polyclonal Antibody
  • Sequence:

    RPKYQSALVCALLWALSCLVTTMEYVMCIDREEESHSRNDCRAVIIFIAI
  • Applications:

    IHC, WB
  • Purification:

    Protein A purified
  • Assay Protocol:

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Concentration:

    1.0 mg/ml
  • Homology:

    Guinea Pig: 77%; Human: 100%; Mouse: 77%; Rat: 77%
  • Format:

    Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  • Reconstitution:

    For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
  • Molecular Weight:

    37 kDa
  • Protein Length:

    325
  • NCBI Gene Symbol:

    MAS1
  • Host or Source:

    Rabbit
  • Protein Name:

    Proto-oncogene Mas
  • Gene Name URL:

    MAS1
  • Nucleotide Accession Number:

    NM_002377