NETO2 Antibody - N-terminal region

• Gene Name:

  Neuropilin (NRP) and tolloid (TLL) -like 2

• Gene Aliases:

  BTCL2, NEOT2

• Gene ID:

  81831

• Swiss Prot:

  Q8NC67

• Accession Number:

  NP_060562

• Reactivity:

  Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit

• Immunogen:

  The immunogen is a synthetic peptide directed towards the N terminal region of human NETO2

• Target:

  NETO2 is a predicted transmembrane protein containing two extracellular CUB domains followed by a low-density lipoprotein class A (LDLa) domain. It also has an intracellular FXNPXY-like motif, which has been shown in other proteins to be essential for the internalization of clathrin coated pits during endocytosis.This gene encodes a predicted transmembrane protein containing two extracellular CUB domains followed by a low-density lipoprotein class A (LDLa) domain. It also has an intracellular FXNPXY-like motif, which has been shown in other proteins to be essential for the internalization of clathrin coated pits during endocytosis. Alternatively spliced transcript variants have been observed, but they have not been fully characterized.

• Partner Proteins:

  ELAVL1

• Clonality:

  Polyclonal

• Type:

  Polyclonal Antibody

• Sequence:

  GIKHIPATQCGIWVRTSNGGHFASPNYPDSYPPNKECIYILEAAPRQRIE

• Applications:

  WB

• Purification:

  Affinity Purified

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Concentration:

  0.5 mg/ml

• Homology:

  Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%

• Format:

  Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

• Reconstitution:

  For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

• Molecular Weight:

  57kDa

• Protein Length:

  525

• NCBI Gene Symbol:

  NETO2

• Host or Source:

  Rabbit

• Protein Name:

  Neuropilin and tolloid-like protein 2

• Gene Name URL:

  NETO2

• CAS Number:

  9007-83-4

• Nucleotide Accession Number:

  NM_018092