MAGEA10 Antibody - middle region

CAT:
247-ARP41864_P050-25UL
Size:
25 µL
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
MAGEA10 Antibody - middle region - image 1

MAGEA10 Antibody - middle region

  • Gene Name:

    Melanoma antigen family A, 10
  • Gene Aliases:

    CT1.10, MAGE10
  • Gene ID:

    4109
  • Swiss Prot:

    P43363
  • Accession Number:

    NP_001011543
  • Reactivity:

    Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
  • Immunogen:

    The immunogen is a synthetic peptide directed towards the middle region of human MAGEA10
  • Target:

    This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. Two transcript variants encoding the same protein have been found for this gene.
  • Partner Proteins:

    UBC
  • Clonality:

    Polyclonal
  • Type:

    Polyclonal Antibody
  • Sequence:

    GSDPRSFPLWYEEALKDEEERAQDRIATTDDTTAMASASSSATGSFSYPE
  • Applications:

    WB
  • Purification:

    Affinity Purified
  • Assay Protocol:

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Concentration:

    0.5 mg/ml
  • Homology:

    Cow: 100%; Dog: 93%; Guinea Pig: 90%; Horse: 91%; Human: 100%; Mouse: 91%; Pig: 100%; Rabbit: 86%; Rat: 100%
  • Format:

    Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  • Reconstitution:

    For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
  • Molecular Weight:

    41kDa
  • Protein Length:

    369
  • NCBI Gene Symbol:

    MAGEA10
  • Host or Source:

    Rabbit
  • Protein Name:

    Melanoma-associated antigen 10
  • Gene Name URL:

    MAGEA10
  • CAS Number:

    9007-83-4
  • Nucleotide Accession Number:

    NM_001011543