PGBD1 Antibody - C-terminal region

CAT:
247-ARP39704_T100-25UL
Size:
25 µL
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
PGBD1 Antibody - C-terminal region - image 1

PGBD1 Antibody - C-terminal region

  • Gene Name:

    PiggyBac transposable element derived 1
  • Gene Aliases:

    SCAND4, HUCEP-4, dJ874C20.4
  • Gene ID:

    84547
  • Swiss Prot:

    Q96JS3
  • Accession Number:

    NP_115896
  • Reactivity:

    Human, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
  • Immunogen:

    The immunogen is a synthetic peptide directed towards the C terminal region of human PGBD1
  • Target:

    PGBD1 belongs to the subfamily of piggyBac transposable element derived (PGBD) genes. The PGBD proteins appear to be novel, with no obvious relationship to other transposases, or other known protein families. This gene product is specifically expressed in the brain, however, its exact function is not known. Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.The piggyBac family of proteins, found in diverse animals, are transposases related to the transposase of the canonical piggyBac transposon from the moth, Trichoplusia ni. This family also includes genes in several genomes, including human, that appear to have been derived from the piggyBac transposons. This gene belongs to the subfamily of piggyBac transposable element derived (PGBD) genes. The PGBD proteins appear to be novel, with no obvious relationship to other transposases, or other known protein families. This gene product is specifically expressed in the brain, however, its exact function is not known.
  • Partner Proteins:

    ZSCAN22; PGBD1; ZNF446; SCAND1; ZNF24; TRAF2; MEOX2; NR4A1
  • Clonality:

    Polyclonal
  • Type:

    Polyclonal Antibody
  • Sequence:

    PQISQPSIVKVYDECKEGVAKMDQIISKYRVRIRSKKWYSILVSYMIDVA
  • Applications:

    WB
  • Purification:

    Protein A purified
  • Assay Protocol:

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Concentration:

    1.0 mg/ml
  • Homology:

    Cow: 100%; Dog: 86%; Guinea Pig: 79%; Horse: 93%; Human: 100%; Pig: 100%; Rabbit: 100%; Rat: 86%
  • Format:

    Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  • Reconstitution:

    For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
  • Molecular Weight:

    93kDa
  • Protein Length:

    809
  • NCBI Gene Symbol:

    PGBD1
  • Host or Source:

    Rabbit
  • Protein Name:

    PiggyBac transposable element-derived protein 1
  • Gene Name URL:

    PGBD1
  • CAS Number:

    9007-83-4
  • Nucleotide Accession Number:

    NM_032507