Runx1 Antibody - N-terminal region

• Gene Name:

  Runt related transcription factor 1

• Gene Aliases:

  AM, AML1, Cbfa, Pebp, Cbfa2, Pebp2a2, Pebpa2b, CBF-alpha-2

• Gene ID:

  12394

• Swiss Prot:

  Q03347-2

• Accession Number:

  NP_033951

• Reactivity:

  Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit

• Immunogen:

  The immunogen is a synthetic peptide directed towards the N-terminal region of MOUSE Runx1

• Target:

  CBF binds to the core site, 5'-PYGPYGGT-3', of a number of enhancers and promoters, including murine leukemia virus, polyomavirus enhancer, T-cell receptor enhancers, LCK, IL-3 and GM-CSF promoters. Runx1 is essential for the development of normal hematopoiesis. Isoform 4 shows higher binding activities for target genes and binds TCR-beta-E2 and RAG-1 target site with threefold higher affinity than other isoforms. It is less effective in the context of neutrophil terminal differentiation. Runx1 acts synergistically with ELF4 to transactivate the IL-3 promoter and with ELF2 to transactivate the BLK promoter. It inhibits KAT6B-dependent transcriptional activation .

• Partner Proteins:

  Kat6a; Ubc; Cbfb; Foxp3; Rbbp4; Gata1; Fli1; Phc1; Cdk6; Cbx3; Bmi1; Pml; Mbd3; Smad2; Prmt1; Hdac2; Hcfc1; Gata2; Hdac1; Wdr5; Mta1; Smarcd1; Pcgf5; Smarcc2; Pold3; Smarce1; Set; Mta2; Ash2l; Tal1; Smarcc1; Smarcb1; Smarca4; Sin3a; Rnf2; Ring1; Cbfa2t3

• Clonality:

  Polyclonal

• Type:

  Polyclonal Antibody

• Sequence:

  KMSEALPLGAPDGGPALASKLRSGDRSMVEVLADHPGELVRTDSPNFLCS

• Applications:

  WB

• Purification:

  Affinity Purified

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Concentration:

  0.5 mg/ml

• Homology:

  Cow: 79%; Dog: 79%; Guinea Pig: 79%; Human: 79%; Mouse: 100%; Rabbit: 79%; Rat: 93%

• Format:

  Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

• Reconstitution:

  For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

• Molecular Weight:

  42kDa

• Protein Length:

  387

• NCBI Gene Symbol:

  RUNX1

• Host or Source:

  Rabbit

• Protein Name:

  Runt-related transcription factor 1

• Gene Name URL:

  Runx1

• CAS Number:

  9007-83-4

• Nucleotide Accession Number:

  NM_009821