TOB1 Antibody - middle region

• Gene Name:

  Transducer of ErbB-2.1

• Gene Aliases:

  To, Tr, Tob, Trob

• Gene ID:

  22057

• Swiss Prot:

  Q640M3

• Accession Number:

  NP_033453

• Reactivity:

  Human, Mouse, Rat, Cow, Dog, Horse, Pig

• Immunogen:

  The immunogen is a synthetic peptide directed towards the middle region of mouse TOB1

• Target:

  Tob1 is a member of antiproliferative family proteins and acts as a bone morphogenic protein inhibitor as well as a suppressor of proliferation in T cells, which have been implicated in postmenopausal bone loss

• Partner Proteins:

  Ctnnb2; smad3a; Smad9; Smad4; Smad5; Smad1

• Clonality:

  Polyclonal

• Type:

  Polyclonal Antibody

• Sequence:

  QPLTFTTATFAATKFGSTKMKNSGRSSKVARTSPINLGLTVNVNDLLKQK

• Applications:

  WB

• Purification:

  Protein A purified

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Concentration:

  1.0 mg/ml

• Homology:

  Cow: 93%; Dog: 93%; Horse: 93%; Human: 93%; Mouse: 100%; Pig: 93%; Rat: 93%

• Format:

  Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

• Reconstitution:

  For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

• Molecular Weight:

  40kDa

• Protein Length:

  362

• NCBI Gene Symbol:

  TOB1

• Host or Source:

  Rabbit

• Protein Name:

  Protein Tob1 Ensembl ENSMUSP00000036039

• Gene Name URL:

  TOB1

• CAS Number:

  9007-83-4

• Nucleotide Accession Number:

  NM_009427