TOB1 Antibody - middle region

• Gene Name :

  Transducer of ErbB-2.1

• Gene Aliases :

  To, Tr, Tob, Trob

• Gene ID :

  22057

• Swiss Prot :

  Q640M3

• Accession Number :

  NP_033453

• Reactivity :

  Human, Mouse, Rat, Cow, Dog, Horse, Pig

• Immunogen :

  The immunogen is a synthetic peptide directed towards the middle region of mouse TOB1

• Target :

  Tob1 is a member of antiproliferative family proteins and acts as a bone morphogenic protein inhibitor as well as a suppressor of proliferation in T cells, which have been implicated in postmenopausal bone loss

• Partner Proteins :

  Ctnnb2; smad3a; Smad9; Smad4; Smad5; Smad1

• Clonality :

  Polyclonal

• Type :

  Polyclonal Antibody

• Sequence :

  QPLTFTTATFAATKFGSTKMKNSGRSSKVARTSPINLGLTVNVNDLLKQK

• Applications :

  WB

• Purification :

  Protein A purified

• Assay Protocol :

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Concentration :

  1.0 mg/ml

• Homology :

  Cow: 93%; Dog: 93%; Horse: 93%; Human: 93%; Mouse: 100%; Pig: 93%; Rat: 93%

• Format :

  Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

• Reconstitution :

  For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

• Molecular Weight :

  40kDa

• Protein Length :

  362

• NCBI Gene Symbol :

  TOB1

• Host or Source :

  Rabbit

• Protein Name :

  Protein Tob1 Ensembl ENSMUSP00000036039

• Gene Name URL :

  TOB1

• CAS Number :

  9007-83-4

• Nucleotide Accession Number :

  NM_009427