Anti-SMARCA2

CAT:
247-ARP34164_P050
Size:
100 µL
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Anti-SMARCA2 - image 1

Anti-SMARCA2

  • Gene Name :

    SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2
  • Gene Aliases :

    BRM, SNF2, SWI2, hBRM, NCBRS, Sth1p, BAF190, SNF2L2, SNF2LA, hSNF2a
  • Gene ID :

    6595
  • Swiss Prot :

    P51531
  • Accession Number :

    NP_001276325.1
  • Reactivity :

    Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
  • Immunogen :

    The immunogen is a synthetic peptide directed towards the N-terminal region of human SMARCA2
  • Target :

    The protein encoded by this gene is a member of the SWI/SNF family of proteins and is highly similar to the brahma protein of Drosophila. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI, which is required for transcriptional activation of genes normally repressed by chromatin. Alternatively spliced transcript variants encoding different isoforms have been found for this gene, which contains a trinucleotide repeat (CAG) length polymorphism.
  • Clonality :

    Polyclonal
  • Type :

    Polyclonal Antibody
  • Sequence :

    EKVPSNSQLEIEGNSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIK
  • Applications :

    WB
  • Purification :

    Affinity Purified
  • Assay Protocol :

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Concentration :

    0.5 mg/ml
  • Homology :

    Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
  • Format :

    Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  • Reconstitution :

    For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
  • Molecular Weight :

    27kDa
  • Protein Length :

    254
  • NCBI Gene Symbol :

    SMARCA2
  • Host or Source :

    Rabbit
  • Protein Name :

    Probable global transcription activator SNF2L2
  • Gene Name URL :

    SMARCA2
  • CAS Number :

    9007-83-4
  • Nucleotide Accession Number :

    NM_001289396.1

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide