SPDEF

• Gene Name:

  SAM pointed domain containing ets transcription factor

• Gene Aliases:

  PDEF, bA375E1.3

• Gene ID:

  25803

• Swiss Prot:

  O95238

• Accession Number:

  NP_036523

• Reactivity:

  Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit

• Immunogen:

  The immunogen is a synthetic peptide directed towards the N terminal region of human SPDEF

• Target:

  PDEF is an ETS transcription factor expressed in prostate epithelial cells. It acts as an androgen-independent transactivator of PSA expression.PDEF is an ETS transcription factor expressed in prostate epithelial cells. It acts as an androgen-independent transactivator of PSA (MIM 176820) expression.[supplied by OMIM].

• Partner Proteins:

  STK11; NKX3-1; PCGF2; AR

• Clonality:

  Polyclonal

• Type:

  Polyclonal Antibody

• Sequence:

  AAAGAVGLERRDWSPSPPATPEQGLSAFYLSYFDMLYPEDSSWAAKAPGA

• Applications:

  WB

• Purification:

  Protein A purified

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Concentration:

  1.0 mg/ml

• Homology:

  Cow: 86%; Dog: 93%; Guinea Pig: 83%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%

• Format:

  Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

• Reconstitution:

  For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

• Molecular Weight:

  38kDa

• Protein Length:

  335

• NCBI Gene Symbol:

  SPDEF

• Host or Source:

  Rabbit

• Protein Name:

  SAM pointed domain-containing Ets transcription factor

• Gene Name URL:

  SPDEF

• Nucleotide Accession Number:

  NM_012391