SPDEF

• Gene Name :

  SAM pointed domain containing ets transcription factor

• Gene Aliases :

  PDEF, bA375E1.3

• Gene ID :

  25803

• Swiss Prot :

  O95238

• Accession Number :

  NP_036523

• Reactivity :

  Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit

• Immunogen :

  The immunogen is a synthetic peptide directed towards the N terminal region of human SPDEF

• Target :

  PDEF is an ETS transcription factor expressed in prostate epithelial cells. It acts as an androgen-independent transactivator of PSA expression.PDEF is an ETS transcription factor expressed in prostate epithelial cells. It acts as an androgen-independent transactivator of PSA (MIM 176820) expression.[supplied by OMIM].

• Partner Proteins :

  STK11; NKX3-1; PCGF2; AR

• Clonality :

  Polyclonal

• Type :

  Polyclonal Antibody

• Sequence :

  AAAGAVGLERRDWSPSPPATPEQGLSAFYLSYFDMLYPEDSSWAAKAPGA

• Applications :

  WB

• Purification :

  Protein A purified

• Assay Protocol :

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Concentration :

  1.0 mg/ml

• Homology :

  Cow: 86%; Dog: 93%; Guinea Pig: 83%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%

• Format :

  Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

• Reconstitution :

  For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

• Molecular Weight :

  38kDa

• Protein Length :

  335

• NCBI Gene Symbol :

  SPDEF

• Host or Source :

  Rabbit

• Protein Name :

  SAM pointed domain-containing Ets transcription factor

• Gene Name URL :

  SPDEF

• Nucleotide Accession Number :

  NM_012391