Blue Fluorescent Protein (BFP)

CAT:

26-4994-5000

Size:

5 mg

Price:

Ask

For price, please contact [email protected]

Description: The recombinant Blue Fluorescent Protein (BFP) is expressed and purified from transformed E. coli using a method that ensures high purity and maximal BFP fluorescence. The protein is a 29 kDa monomer with 259 amino acids, pI: 6.17. Ex.= 308-383 nm; Em.= 440-447 nm. The protein is engineered with 6xHis-tag on the N-terminal, which can be used for detection with anti-His-Tag antibody, or protein removal by using Ni++ beads. BFP protein sequence:MGSSHHHHHHSSGLVPRGSHMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATY GKLTLKFICTTGKLPVPWPTLVTTLSHGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIF FKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHNVYIMADKQKN GIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDSHYLSTQSALSKDPNEKRDHMV LLEFVTAAGITLGMDELYK
Shipping Conditions: Gel pack
Storage Conditions: -20°C
Shelf Life: 12 months

Cat	Name
4994-100	Blue Fluorescent Protein (BFP)
4994-1000	Blue Fluorescent Protein (BFP)
4994-5000	Blue Fluorescent Protein (BFP)
4993-1000	mCherry Fluorescent Protein
4996-5000	Cyan Fluorescent Protein
4998-1000	Yellow Fluorescent Protein
4998-5000	Yellow Fluorescent Protein
K816-6-100	Fluorescent Protein Set
4996-1000	Cyan Fluorescent Protein
4998-100	Yellow Fluorescent Protein

Cat	Name
FP-0567-2	Fluorescent PAK Blue
MBS225346-02	Rabbit anti Blue Fluorescent Protein
abx412394-02	Blue Fluorescent Protein (BFP) Antibody
E4703-01	Enhanced Blue Fluorescent Protein EBFP
abx412394-01	Blue Fluorescent Protein (BFP) Antibody
MBS225346-01	Rabbit anti Blue Fluorescent Protein
MBS636369-01	Blue Fluorescent Protein, Recombinant (BFP)
80R-2547	Blue Fluorescent protein (His tag)
MBS636369-02	Blue Fluorescent Protein, Recombinant (BFP)
abx375284	Enhanced Blue Fluorescent Protein (EYFP) Antibody