ECH1, Human (His)

• Description :

  ECH1 Protein plays a crucial role in isomerization, converting 3-trans,5-cis-dienoyl-CoA to its isomeric form, 2-trans,4-trans-dienoyl-CoA. This enzymatic step is vital in metabolic pathways, ensuring the equilibrium of dienoyl-CoA species and contributing to overall metabolic flux. ECH1's activity is essential for maintaining structural rearrangement in Coenzyme A (CoA) -linked intermediates, emphasizing its significance in cellular processes. ECH1 Protein, Human (His) is the recombinant human-derived ECH1 protein, expressed by E. coli , with N-6*His labeled tag.

• Product Name Alternative :

  ECH1 Protein, Human (His), Human, E. coli

• UNSPSC :

  12352202

• Type :

  Recombinant Proteins

• Assay Protocol :

  https://www.medchemexpress.com/cytokines/ech1-protein-human-his.html

• Purity :

  98.0

• Smiles :

  TGSSAQEEASGVALGEAPDHSYESLRVTSAQKHVLHVQLNRPNKRNAMNKVFWREMVECFNKISRDADCRAVVISGAGKMFTAGIDLMDMASDILQPKGDDVARISWYLRDIITRYQETFNVIERCPKPVIAAVHGGCIGGGVDLVTACDIRYCAQDAFFQVKEVDVGLAADVGTLQRLPKVIGNQSLVNELAFTARKMMADEALGSGLVSRVFPDKEVMLDAALALAAEISSKSPVAVQSTKVNLLYSRDHSVAESLNYVASWNMSMLQTQDLVKSVQATTENKELKTVTFSKL

• Molecular Formula :

  1891 (Gene_ID) Q13011 (T34-L328) (Accession)

• Molecular Weight :

  30-35 kDa

• Shipping Conditions :

  Dry ice

• Storage Conditions :

  Stored at -80°C for 1 year

• Scientific Category :

  Recombinant Proteins