Recombinant Human Androgen-dependent TFPI-regulating protein (ADTRP)

• Product Name Alternative:

  C6orf105

• Abbreviation:

  Recombinant Human ADTRP protein

• Gene Name:

  ADTRP

• UniProt:

  Q96IZ2

• Expression Region:

  1-230aa

• Organism:

  Homo sapiens (Human)

• Target Sequence:

  MTKTSTCIYHFLVLSWYTFLNYYISQEGKDEVKPKILANGARWKYMTLLNLLLQTIFYGVTCLDDVLKRTKGGKDIKFLTAFRDLLFTTLAFPVSTFVFLAFWILFLYNRDLIYPKVLDTVIPVWLNHAMHTFIFPITLAEVVLRPHSYPSKKTGLTLLAAASIAYISRILWLYFETGTWVYPVFAKLSLLGLAAFFSLSYVFIASIYLLGEKLNHWKWGDMRQPRKKRK

• Tag:

  N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

• Type:

  CF Transmembrane Protein & Developed Protein

• Source:

  In vitro E.coli expression system

• Field of Research:

  Others

• Relevance:

  Regulates the expression and the cell-associated anticoagulant activity of the inhibitor TFPI in endothelial cells

• Endotoxin:

  Not test

• Purity:

  Greater than 90% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Function:

  Regulates the expression and the cell-associated anticoagulant activity of the inhibitor TFPI in endothelial cells (in vitro) .

• Molecular Weight:

  46.8 kDa

• References & Citations:

  "Next-generation sequencing to generate interactome datasets." Yu H., Tardivo L., Tam S., Weiner E., Gebreab F., Fan C., Svrzikapa N., Hirozane-Kishikawa T., Rietman E., Yang X., Sahalie J., Salehi-Ashtiani K., Hao T., Cusick M.E., Hill D.E., Roth F.P., Braun P., Vidal M. Nat. Methods 8:478-480 (2011)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Full Length