BDNF, Human

CAT:
804-HY-P7116A-01
Size:
2 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
BDNF, Human - image 1

BDNF, Human

  • Description :

    Brain Derived Neurotrophic Factor (BDNF) is a neurotrophin that belongs to NGF-beta family. BDNF can bind to its high affinity receptor TrkB and activates signal transduction cascades (IRS1/2, PI3K, Akt) [1]. BDNF can also bind to the p75NTR, but the affinity for the p75NTR receptor is lower than for TrkB[2]. BDNF is a neurotransmitter modulator, and is vital in maturation, survival and differentiation of neuronal populations during development. BDNF also participates in neuronal plasticity, which is essential for learning and memory. BDNF is widely expressed in the CNS[1]. BDNF Protein, Human is a recombinant human BDNF (H129-R247) without tag, which is produced in E.coli.
  • Product Name Alternative :

    BDNF Protein, Human, Human, E. coli
  • UNSPSC :

    12352202
  • Type :

    Recombinant Proteins
  • Assay Protocol :

    https://www.medchemexpress.com/cytokines/bdnf-protein-human.html
  • Purity :

    98.0
  • Smiles :

    HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR
  • Molecular Formula :

    627 (Gene_ID) P23560-1 (H129-R247) (Accession)
  • Molecular Weight :

    Approximately 14-19 kDa, based on SDS-PAGE under reducing conditions.
  • References & Citations :

    [1]Li M, et al. Recombinant human brain-derived neurotrophic factor prevents neuronal apoptosis in a novel in vitro model of subarachnoid hemorrhage. Neuropsychiatr Dis Treat. 2017 Apr 3;13:1013-1021.|[2]Hang P, et al. Brain-derived neurotrophic factor attenuates doxorubicin-induced cardiac dysfunction through activating Akt signalling in rats. J Cell Mol Med. 2017 Apr;21 (4) :685-696.|[3]Bathina S, et al. Brain-derived neurotrophic factor and its clinical implications. Arch Med Sci. 2015 Dec 10;11 (6) :1164-78.|[4]Lima Giacobbo B, et al. Brain-Derived Neurotrophic Factor in Brain Disorders: Focus on Neuroinflammation. Mol Neurobiol. 2019 May;56 (5) :3295-3312.|[5]Egan MF, et al. The BDNF val66met polymorphism affects activity-dependent secretion of BDNF and human memory and hippocampal function. Cell. 2003 Jan 24;112 (2) :257-69.|[6]Alonso M, et al. Signaling mechanisms mediating BDNF modulation of memory formation in vivo in the hippocampus. Cell Mol Neurobiol. 2002 Dec;22 (5-6) :663-74.
  • Shipping Conditions :

    Room temperature in continental US; may vary elsewhere.
  • Storage Conditions :

    Stored at -20°C for 2 years
  • Scientific Category :

    Recombinant Proteins