Recombinant Human Pulmonary surfactant-associated protein B (SFTPB)

CAT:
399-CSB-BP021173HU-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Human Pulmonary surfactant-associated protein B (SFTPB) - image 1

Recombinant Human Pulmonary surfactant-associated protein B (SFTPB)

  • Product Name Alternative:

    18 kDa pulmonary-surfactant protein 6 kDa protein Pulmonary surfactant-associated proteolipid SPL (Phe)
  • Abbreviation:

    Recombinant Human SFTPB protein
  • Gene Name:

    SFTPB
  • UniProt:

    P07988
  • Expression Region:

    201-279aa
  • Organism:

    Homo sapiens (Human)
  • Target Sequence:

    FPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVCRVVPLVAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSM
  • Tag:

    N-terminal MBP-tagged
  • Type:

    In Stock Protein
  • Source:

    Baculovirus
  • Field of Research:

    Cardiovascular
  • Relevance:

    Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter.
  • Endotoxin:

    Not test
  • Purity:

    Greater than 85% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Function:

    Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter.
  • Molecular Weight:

    50.7 kDa
  • References & Citations:

    "Use of human surfactant low molecular weight apoproteins in the reconstitution of surfactant biologic activity." Revak S.D., Merritt T.A., Degryse E., Stefani L., Courtney M., Hallman M., Cochrane C.G. J. Clin. Invest. 81:826-833 (1988)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Full Length of Mature Protein