Recombinant Human Hemoglobin subunit gamma-1 (HBG1)

CAT:
399-CSB-EP010155HU-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Human Hemoglobin subunit gamma-1 (HBG1) - image 1

Recombinant Human Hemoglobin subunit gamma-1 (HBG1)

  • Product Name Alternative:

    Gamma-1-globin (Hb F Agamma) (Hemoglobin gamma-1 chain) (Hemoglobin gamma-A chain)
  • Abbreviation:

    Recombinant Human HBG1 protein
  • Gene Name:

    HBG1
  • UniProt:

    P69891
  • Expression Region:

    2-147aa
  • Organism:

    Homo sapiens (Human)
  • Target Sequence:

    GHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVLTSLGDAIKHLDDLKGTFAQLSELHCDKLHVDPENFKLLGNVLVTVLAIHFGKEFTPEVQASWQKMVTAVASALSSRYH
  • Tag:

    N-terminal 10xHis-tagged and C-terminal Myc-tagged
  • Type:

    In Stock Protein
  • Source:

    E.coli
  • Field of Research:

    Signal Transduction
  • Relevance:

    Gamma chains make up the fetal hemoglobin F, in combination with alpha chains.
  • Endotoxin:

    Not test
  • Purity:

    Greater than 85% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Function:

    Gamma chains make up the fetal hemoglobin F, in combination with alpha chains.
  • Molecular Weight:

    23.0 kDa
  • References & Citations:

    "Fetal hemoglobin levels and morbidity in untransfused patients with beta-thalassemia intermedia." Musallam K.M., Sankaran V.G., Cappellini M.D., Duca L., Nathan D.G., Taher A.T. Blood 119:364-367 (2012)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Full Length of Mature Protein