Recombinant Cyprinus carpio Granulin-3

• Product Name Alternative:

  Granulin-3

• Abbreviation:

  Recombinant Cyprinus carpio Granulin-3 protein

• UniProt:

  P81015

• Expression Region:

  1-57aa

• Organism:

  Cyprinus carpio (Common carp)

• Target Sequence:

  VVFCDAGITCPSGTTCCRSPFGVWYCCPFLMGQCCRDGRHCCRHGYHCDSTSTLCLR

• Tag:

  N-terminal 10xHis-tagged and C-terminal Myc-tagged

• Type:

  Developed Protein

• Source:

  E.coli

• Field of Research:

  Others

• Relevance:

  Granulins have possible cytokine-like activity. They may play a role in inflammation, wound repair, and tissue remodeling.

• Endotoxin:

  Not test

• Purity:

  Greater than 90% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Function:

  Granulins have possible cytokine-like activity. They may play a role in inflammation, wound repair, and tissue remodeling.

• Molecular Weight:

  13.3 kDa

• References & Citations:

  "Isolation and primary structure of the three major forms of granulin-like peptides from hematopoietic tissues of a teleost fish (Cyprinus carpio) ." Belcourt D.R., Lazure C., Bennett H.P. J. Biol. Chem. 268:9230-9237 (1993)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Full Length