Recombinant Mouse CB1 cannabinoid receptor-interacting protein 1 (Cnrip1)

CAT:
399-CSB-YP705797MO-01
Size:
20 µg

For Laboratory Research Only. Not for Clinical or Personal Use.

  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Mouse CB1 cannabinoid receptor-interacting protein 1 (Cnrip1) - image 1

Recombinant Mouse CB1 cannabinoid receptor-interacting protein 1 (Cnrip1)

  • Product Name Alternative:

    Cnrip1CB1 cannabinoid receptor-interacting protein 1; CRIP-1
  • Abbreviation:

    Recombinant Mouse Cnrip1 protein
  • Gene Name:

    Cnrip1
  • UniProt:

    Q5M8N0
  • Expression Region:

    1-464aa
  • Organism:

    Mus musculus (Mouse)
  • Target Sequence:

    MGDLPGLVRLSIALRIQPNDGPVFFKVDGQRFGQNRTIKLLTGSSYKVEVKIKPTTLQVENISIGGVLVPLELKGKEPDGERVVYTGIYDTEGVAPTKSGERQPIQITMPFTDIGTFETVWQVKFYNYHKRDHCQWGSPFSVIEYECKPNETRSLMWVNKESFL
  • Tag:

    N-terminal 10xHis-tagged and C-terminal Myc-tagged
  • Type:

    Developed Protein
  • Source:

    Yeast
  • Field of Research:

    Neuroscience
  • Relevance:

    Suppresses cannabinoid receptor CNR1-mediated tonic inhibition of voltage-gated calcium channels.
  • Endotoxin:

    Not test
  • Purity:

    Greater than 85% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Function:

    Suppresses cannabinoid receptor CNR1-mediated tonic inhibition of voltage-gated calcium channels.
  • Molecular Weight:

    22.6 kDa
  • References & Citations:

    "CB1 cannabinoid receptor activity is modulated by the cannabinoid receptor interacting protein CRIP 1a." Niehaus J.L., Liu Y., Wallis K.T., Egertova M., Bhartur S.G., Mukhopadhyay S., Shi S., He H., Selley D.E., Howlett A.C., Elphick M.R., Lewis D.L. Mol. Pharmacol. 72:1557-1566 (2007)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Full Length