Recombinant Pig Saposin-B-Val (PSAP)

• Product Name Alternative:

  Cerebroside sulfate activator (CS-ACT) (Non-specific activator) (Sphingolipid activator protein 1) (SAP-1)

• Abbreviation:

  Recombinant Pig PSAP protein

• Gene Name:

  PSAP

• UniProt:

  P81405

• Expression Region:

  1-80aa

• Organism:

  Sus scrofa (Pig)

• Target Sequence:

  GDVCQDCIQMVTDLQNAVRTNSTFVEALVNHAKEECDRLGPGMADMCKNYISQYSEIAIQMMMHMQPKDICGLVGFCEEV

• Tag:

  N-terminal 6xHis-Flag-tagged

• Type:

  In Stock Protein

• Source:

  Yeast

• Field of Research:

  Metabolism

• Relevance:

  Saposin-B stimulates the hydrolysis of galacto-cerebroside sulfate by arylsulfatase A (EC 3.1.6.8), GM1 gangliosides by beta-galactosidase (EC 3.2.1.23) and globotriaosylceramide by alpha-galactosidase A (EC 3.2.1.22) . Saposin-B forms a solubilizing complex with the substrates of the sphingolipid hydrolases.

• Endotoxin:

  Not test

• Purity:

  Greater than 90% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Function:

  Saposin-B stimulates the hydrolysis of galacto-cerebroside sulfate by arylsulfatase A (EC 3.1.6.8), GM1 gangliosides by beta-galactosidase (EC 3.2.1.23) and globotriaosylceramide by alpha-galactosidase A (EC 3.2.1.22) . Saposin-B forms a solubilizing complex with the substrates of the sphingolipid hydrolases.

• Molecular Weight:

  11.9 kDa

• References & Citations:

  "Porcine cerebroside sulfate activator: further structural characterization and disulfide identification." Stevens R.L., Faull K.F., Conklin K.A., Green B.N., Fluharty A.L. Biochemistry 32:4051-4059 (1993)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Full Length