Recombinant Pig Calcium-activated chloride channel regulator 1 (CLCA1), partial

CAT:
399-CSB-EP886948PI-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Pig Calcium-activated chloride channel regulator 1 (CLCA1), partial - image 1

Recombinant Pig Calcium-activated chloride channel regulator 1 (CLCA1), partial

  • Product Name Alternative:

    Calcium-activated chloride channel family member 1 pCLCA1 AECC
  • Abbreviation:

    Recombinant Pig CLCA1 protein, partial
  • Gene Name:

    CLCA1
  • UniProt:

    Q9TUB5
  • Expression Region:

    46-199aa
  • Organism:

    Sus scrofa (Pig)
  • Target Sequence:

    DERLIQNIKDMVTKASPYLFEATEKRFYFKNVAILIPASWKAKPEYVKPKLETYKNADVVVTEPNPPENDGPYTEQMGNCGEKGEKIYFTPDFVAGKKVLQYGPQGRVFVHEWAHLRWGVFNEYNNEQKFYLSNKKEQPVICSAAIRGTNVLPQ
  • Tag:

    N-terminal 10xHis-tagged and C-terminal Myc-tagged
  • Type:

    Developed Protein
  • Source:

    E.coli
  • Field of Research:

    Signal Transduction
  • Relevance:

    May be involved in mediating calcium-activated chloride conductance. May play critical roles in goblet cell metaplasia, mucus hypersecretion, cystic fibrosis and AHR. May be involved in the regulation of mucus production and/or secretion by goblet cells. Involved in the regulation of tissue inflammation in the innate immune response. May play a role as a tumor suppressor. Induces MUC5AC. Induces a cAMP-dependent chloride conductance possibly through effects on CFTR in colon carcinoma cells.
  • Endotoxin:

    Not test
  • Purity:

    Greater than 85% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Function:

    May be involved in mediating calcium-activated chloride conductance. May play critical roles in goblet cell metaplasia, mucus hypersecretion, cystic fibrosis and AHR. May be involved in the regulation of mucus production and/or secretion by goblet cells. Involved in the regulation of tissue inflammation in the innate immune response. May play a role as a tumor suppressor. Induces MUC5AC. Induces a cAMP-dependent chloride conductance possibly through effects on CFTR in colon carcinoma cells.
  • Molecular Weight:

    22.8 kDa
  • References & Citations:

    "pCLCA1 lacks inherent chloride channel activity in an epithelial colon carcinoma cell line." Loewen M.E., Bekar L.K., Walz W., Forsyth G.W., Gabriel S.E. Am. J. Physiol. 287:G33-G41 (2004)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Partial

Alternative Products

CAT

Name

P2354Recombinant human Calcium-activated chloride channel regulator 1
P2785Recombinant human Calcium-activated chloride channel regulator 2
MBS645629-01CLCA2 (Calcium-activated Chloride Channel Regulator 2, Calcium-activated Chloride Channel Family Member 2, hCLCA2, Calcium-activated Chloride Channel Protein 3, CaCC-3, hCaCC-3, CACC3)
MBS6009235-01CLCA1 (Calcium-activated Chloride Channel Regulator 1, Calcium-activated Chloride Channel Family Member 1, hCLCA1, Calcium-activated Chloride Channel Protein 1, CaCC-1, hCaCC-1, CACC1)
MBS641697-01CLCA1 (Calcium-activated Chloride Channel Regulator 1, Calcium-activated Chloride Channel Family Member 1, hCLCA1, Calcium-activated Chloride Channel Protein 1, CaCC-1, hCaCC-1, CACC1)
MBS645218-01CLCA1 (Calcium-activated Chloride Channel Regulator 1, Calcium-activated Chloride Channel Family Member 1, hCLCA1, Calcium-activated Chloride Channel Protein 1, CaCC-1, hCaCC-1, CACC1)
MBS645644-01CLCA1 (Calcium-activated Chloride Channel Regulator 1, Calcium-activated Chloride Channel Family Member 1, hCLCA1, Calcium-activated Chloride Channel Protein 1, CaCC-1, hCaCC-1, CACC1)
MBS6135923-01CLCA1 (Calcium-activated Chloride Channel Regulator 1, Calcium-activated Chloride Channel Family Member 1, hCLCA1, Calcium-activated Chloride Channel Protein 1, CaCC-1, hCaCC-1, CACC1) APC
MBS6135924-01CLCA2 (Calcium-activated Chloride Channel Regulator 2, Calcium-activated Chloride Channel Family Member 2, hCLCA2, Calcium-activated Chloride Channel Protein 3, CaCC-3, hCaCC-3, CACC3) APC
MBS6146529-01CLCA1 (Calcium-activated Chloride Channel Regulator 1, Calcium-activated Chloride Channel Family Member 1, hCLCA1, Calcium-activated Chloride Channel Protein 1, CaCC-1, hCaCC-1, CACC1) (FITC)