Recombinant Tuber borchii Cyanovirin-N homolog

CAT:
399-CSB-EP692568TJE-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Tuber borchii Cyanovirin-N homolog - image 1

Recombinant Tuber borchii Cyanovirin-N homolog

  • Product Name Alternative:

    Cyanovirin-N homolog; CV-N homolog
  • Abbreviation:

    Recombinant Tuber borchii Cyanovirin-N homolog protein
  • UniProt:

    Q5MK11
  • Expression Region:

    1-103aa
  • Organism:

    Tuber borchii (White truffle)
  • Target Sequence:

    MSYADSSRNAVLTNGGRTLRAECRNADGNWVTSELDLDTCIGNPNGFLGWGMQNFSHSSEDIKLEEGGRKLTCRPKTVDGGFRERQGIDLNRIQNVNGRLVFQ
  • Tag:

    N-terminal 6xHis-tagged
  • Type:

    Developed Protein
  • Source:

    E.coli
  • Field of Research:

    Others
  • Relevance:

    Mannose-binding lectin.
  • Endotoxin:

    Not test
  • Purity:

    Greater than 85% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Function:

    Mannose-binding lectin.
  • Molecular Weight:

    15.4 kDa
  • References & Citations:

    "Gene expression profiling of the nitrogen starvation stress response in the mycorrhizal ascomycete Tuber borchii." Montanini B., Gabella S., Abba S., Peter M., Kohler A., Bonfante P., Chalot M., Martin F., Ottonello S. Fungal Genet. Biol. 43:630-641 (2006)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Full Length