Recombinant Escherichia coli Beta-lactamase TEM (bla)

CAT:
399-CSB-EP352353ENL-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Escherichia coli Beta-lactamase TEM (bla) - image 1

Recombinant Escherichia coli Beta-lactamase TEM (bla)

  • Product Name Alternative:

    IRT-4PenicillinaseTEM-1TEM-16/CAZ-7TEM-2TEM-24/CAZ-6TEM-3TEM-4TEM-5TEM-6TEM-8/CAZ-2
  • Abbreviation:

    Recombinant E.coli bla protein
  • Gene Name:

    Bla
  • UniProt:

    P62593
  • Expression Region:

    24-286aa
  • Organism:

    Escherichia coli
  • Target Sequence:

    HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
  • Tag:

    N-terminal 6xHis-SUMO-tagged
  • Type:

    In Stock Protein
  • Source:

    E.coli
  • Field of Research:

    Others
  • Relevance:

    T-type are the most prevalent beta-lactamases in enterobacteria; they hydrolyze the beta-lactam bond in susceptible beta-lactam antibiotics, thus conferring resistance to penicillins and cephalosporins. T-3 and T-4 are capable of hydrolyzing cefotaxime and ceftazidime. T-5 is capable of hydrolyzing ceftazidime. T-6 is capable of hydrolyzing ceftazidime and aztreonam. T-8/CAZ-2, T-16/CAZ-7 and T-24/CAZ-6 are markedly active against ceftazidime. IRT-4 shows resistance to beta-lactamase inhibitors.
  • Endotoxin:

    Not test
  • Purity:

    Greater than 90% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Function:

    TEM-type are the most prevalent beta-lactamases in enterobacteria; they hydrolyze the beta-lactam bond in susceptible beta-lactam antibiotics, thus conferring resistance to penicillins and cephalosporins. TEM-3 and TEM-4 are capable of hydrolyzing cefotaxime and ceftazidime. TEM-5 is capable of hydrolyzing ceftazidime. TEM-6 is capable of hydrolyzing ceftazidime and aztreonam. TEM-8/CAZ-2, TEM-16/CAZ-7 and TEM-24/CAZ-6 are markedly active against ceftazidime. IRT-4 shows resistance to beta-lactamase inhibitors.
  • Molecular Weight:

    44.9 kDa
  • References & Citations:

    Beta-lactamase TEM1 of E. coli. Crystal structure determination at 2.5-A resolution.Jelsch C., Lenfant F., Masson J.-M., Samama J.-P.FEBS Lett. 299:135-142 (1992)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Full Length of Mature Protein