Recombinant Human papillomavirus type 52 Protein E7 (E7)

CAT: 0399-CSB-EP339740HNY-01Size: 20 µgDry Ice: NoHazardous: No

1 / 1

CAT#:0399-CSB-EP339740HNY-01Size:20 µg

Selected

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

Quick Request Actions

Product Name Alternative

E7Protein E7

Abbreviation

Recombinant Human papillomavirus type 52 E7 protein

Gene Name

UniProt

P36831

Expression Region

1-99aa

Organism

Human papillomavirus type 52

Target Sequence

MRGDKATIKDYILDLQPETTDLHCYEQLGDSSDEEDTDGVDRPDGQAEQATSNYYIVTYCHSCDSTLRLCIHSTATDLRTLQQMLLGTLQVVCPGCARL

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

E7 protein has both transforming and trans-activating activities. Disrupts the function of host retinoblastoma protein RB1/pRb, which is a key regulator of the cell cycle. Induces the disassbly of the E2F1 transcription factors from RB1, with subsequent transcriptional activation of E2F1-regulated S-phase genes. Inactivation of the ability of RB1 to arrest the cell cycle is critical for cellular transformation, uncontrolled cellular growth and proliferation induced by viral infection. Stimulation of progression from G1 to S phase allows the virus to efficiently use the cellular DNA replicating machinery to achieve viral genome replication. Interferes with histone deacetylation mediated by HDAC1 and HDAC2, leading to activation of transcription .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Plays a role in viral genome replication by driving entry of quiescent cells into the cell cycle. Stimulation of progression from G1 to S phase allows the virus to efficiently use the cellular DNA replicating machinery to achieve viral genome replication. E7 protein has both transforming and trans-activating activities. Induces the disassembly of the E2F1 transcription factor from RB1, with subsequent transcriptional activation of E2F1-regulated S-phase genes. Interferes with host histone deacetylation mediated by HDAC1 and HDAC2, leading to transcription activation. Plays also a role in the inhibition of both antiviral and antiproliferative functions of host interferon alpha. Interaction with host TMEM173/STING impairs the ability of TMEM173/STING to sense cytosolic DNA and promote the production of type I interferon (IFN-alpha and IFN-beta) .

Molecular Weight

27 kDa

References & Citations

Interactions of SV40 large T antigen and other viral proteins with retinoblastoma tumour suppressor.Lee C., Cho Y.Rev. Med. Virol. 12:81-92 (2002)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

UniProtKB · P36831

Protein E7

VE7_HPV52 · Human papillomavirus 52

View on UniProt ↗

Primary accession: P36831
Review status: UniProtKB reviewed (Swiss-Prot)
Gene: E7
Protein existence: 3: Inferred from homology
Organism: Human papillomavirus 52
Taxonomy ID: 10618
Alternative names: —
EC number: —
Processing: —
Secondary accessions: —

Protein keywords

Molecular function

ActivatorDNA-binding

Developmental stage

Early protein

Biological process

G1/S host cell cycle checkpoint dysregulation by virusHost-virus interactionInhibition of host innate immune response by virusInhibition of host interferon signaling pathway by virusInterferon antiviral system evasionModulation of host cell cycle by virusTranscriptionTranscription regulationViral immunoevasion

Cellular component

Host cytoplasmHost nucleus

Ligand

Metal-bindingZinc

Disease

Oncogene

Technical term

Reference proteome

Domain

Zinc-finger

Related Products

Catalog	Name
CSB-EP365855HMLe0-01	Recombinant Human papillomavirus type 16 Protein E7 (E7)
CSB-EP365855HML-01	Recombinant Human papillomavirus type 16 Protein E7 (E7)
CSB-YP365855HML-01	Recombinant Human papillomavirus type 16 Protein E7 (E7)
CSB-EP327601HNZ-01	Recombinant Human papillomavirus type 53 Protein E7 (E7)
CSB-MP365855HML-01	Recombinant Human papillomavirus type 16 Protein E7 (E7)
CSB-EP361948HMN-01	Recombinant Human papillomavirus type 18 Protein E7 (E7)
CSB-EP330647HNG-01	Recombinant Human papillomavirus type 34 Protein E7 (E7)
CSB-EP339739HMW-01	Recombinant Human papillomavirus type 26 Protein E7 (E7)
CSB-YP361948HMN-01	Recombinant Human papillomavirus type 18 Protein E7 (E7)
CSB-EP365855HMLg5-01	Recombinant Human papillomavirus type 16 Protein E7 (E7) (Active)

Alternative Products

Catalog	Name
527312-01	Protein E7 (Papillomavirus Type 16 Protein E7)
327457-01	Papillomavirus type 18 Protein E7
90147	Papillomavirus type 16 E7 protein
MBS1000515-01	Recombinant Human papillomavirus type 18 Protein E7 (E7)
RPC28609-01	Recombinant Human papillomavirus type 11 Protein E7 (E7)
GTR19123582-01	Recombinant Human papillomavirus type 26 Protein E7 (E7)
GTR19026759-01	Recombinant Human papillomavirus type 52 Protein E7 (E7)
030154	E7 (E7 transforming protein (Human papillomavirus type 16)
MBS1247472-01	Recombinant Rhesus papillomavirus type 1 Protein E7 (E7)
MBS7062920-01	Recombinant Human papillomavirus type 16 Protein E7 (E7)