Products for Research Use Only
RegisterLogin

Recombinant Human Proteasome subunit beta type-8 (PSMB8)

CAT: 0399-CSB-EP018886HU-01Size: 20 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0399-CSB-EP018886HU-01Size:20 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Product Name Alternative
Low molecular mass protein 7 Macropain subunit C13 Multicatalytic endopeptidase complex subunit C13 Proteasome component C13 Proteasome subunit beta-5i Really interesting new gene 10 protein
Abbreviation
Recombinant Human PSMB8 protein
Gene Name
PSMB8
UniProt
P28062
Expression Region
73-276aa
Organism
Homo sapiens (Human)
Target Sequence
TTTLAFKFQHGVIAAVDSRASAGSYISALRVNKVIEINPYLLGTMSGCAADCQYWERLLAKECRLYYLRNGERISVSAASKLLSNMMCQYRGMGLSMGSMICGWDKKGPGLYYVDEHGTRLSGNMFSTGSGNTYAYGVMDSGYRPNLSPEEAYDLGRRAIAYATHRDSYSGGVVNMYHMKEDGWVKVESTDVSDLLHQYREANQ
Tag
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Type
In Stock Protein
Source
E.coli
Field of Research
Cell Biology
Relevance
The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. This subunit is involved in antigen processing to generate class I binding peptides. Replacement of PSMB5 by PSMB8 increases the capacity of the immunoproteasome to cleave model peptides after hydrophobic and basic residues. Acts as a major component of interferon gamma-induced sensitivity. Plays a key role in apoptosis via the degradation of the apoptotic inhibitor MCL1. May be involved in the inflammatory response pathway. In cancer cells, substitution of isoform 1 (E2) by isoform 2 (E1) results in immunoproteasome deficiency. Required for the differentiation of preadipocytes into adipocytes.
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Form
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Function
The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. This subunit is involved in antigen processing to generate class I binding peptides. Replacement of PSMB5 by PSMB8 increases the capacity of the immunoproteasome to cleave model peptides after hydrophobic and basic residues. Acts as a major component of interferon gamma-induced sensitivity. Plays a key role in apoptosis via the degradation of the apoptotic inhibitor MCL1. May be involved in the inflammatory response pathway. In cancer cells, substitution of isoform 1 (E2) by isoform 2 (E1) results in immunoproteasome deficiency. Required for the differentiation of preadipocytes into adipocytes.
Molecular Weight
42.7 kDa
References & Citations
"The major histocompatibility complex-encoded proteasome component LMP7: alternative first exons and post-translational processing." Glynne R., Kerr L.A., Mockridge I., Beck S., Kelly A., Trowsdale J. Eur. J. Immunol. 23:860-866 (1993)
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Protein Length
Full Length of Mature Protein

UniProtKB · P28062

Proteasome subunit beta type-8

PSB8_HUMAN · Homo sapiens

View on UniProt ↗
Primary accession
P28062
Review status
UniProtKB reviewed (Swiss-Prot)
Gene
PSMB8
Protein existence
1: Evidence at protein level
Organism
Homo sapiens (Human)
Taxonomy ID
9606
Alternative names
—
EC number
3.4.25.1
Processing
Precursor
Secondary accessions
B0UZC0, Q29824, Q5JNW6, Q5QNR8, Q96J48
Protein keywords

Technical term

3D-structureProteomics identificationReference proteome

Coding sequence diversity

Alternative splicing

Cellular component

CytoplasmNucleusProteasome

Biological process

DifferentiationHost-virus interactionImmunity

Disease

Disease variant

Molecular function

HydrolaseProteaseThreonine protease

PTM

PhosphoproteinZymogen

Related Products

CatalogName
CSB-RP013854h-01Human Proteasome subunit beta type-2 (PSMB2)
CSB-EP018880HU-01Recombinant Human Proteasome subunit beta type-3 (PSMB3)
CSB-RP013954h-01Recombinant Human Proteasome subunit beta type-1 (PSMB1)
CSB-EP018879HU-01Recombinant Human Proteasome subunit beta type-2 (PSMB2)
CSB-RP013744h-01Recombinant Human Proteasome subunit beta type-4 (PSMB4)
CSB-RP013454h-01Recombinant Human Proteasome subunit beta type-7 (PSMB7), partial
CSB-EP018877HU-01Recombinant Human Proteasome subunit beta type-10 (PSMB10)
CSB-E17836h-01Human proteasome (prosome, macropain) subunit, beta type, 2 (PSMB2) ELISA kit
CSB-EP018865HU-01Recombinant Human Proteasome subunit alpha type-1 (PSMA1), partial
CSB-RP013354h-01Recombinant Human Proteasome subunit alpha type-7 (PSMA7), partial

Alternative Products

CatalogName
abx344237-01Proteasome subunit beta type-8 (PSMB8) Antibody
abx211178-01Proteasome Subunit Beta Type 8 (PSMB8) Antibody
abx615945Proteasome Subunit Beta Type 8 (PSMB8) Peptide
MBS952235-01Recombinant Rat Proteasome subunit beta type-8 (Psmb8)
A02188-2Anti-Proteasome subunit beta type-8 PSMB8 Antibody
MBS1408666-01Recombinant Bovine Proteasome subunit beta type-8 (PSMB8)
MBS961824-01Recombinant Human Proteasome subunit beta type-8 (PSMB8)
abx067716-01Rat Proteasome Subunit Beta Type 8 (PSMB8) Protein
abx067715-01Mouse Proteasome Subunit Beta Type 8 (PSMB8) Protein
MBS1405795-01Recombinant Pig Proteasome subunit beta type-8 (PSMB8)

Popular Products