Recombinant Vibrio cholerae serotype O1 Cholera enterotoxin subunit B (ctxB)

CAT:
399-CSB-EP360704VEX-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Vibrio cholerae serotype O1 Cholera enterotoxin subunit B (ctxB) - image 1

Recombinant Vibrio cholerae serotype O1 Cholera enterotoxin subunit B (ctxB)

  • Product Name Alternative:

    Cholera enterotoxin B chain Cholera enterotoxin gamma chain Choleragenoid
  • Abbreviation:

    Recombinant Vibrio cholerae serotype O1 ctxB protein
  • Gene Name:

    CtxB
  • UniProt:

    P01556
  • Expression Region:

    22-124aa
  • Organism:

    Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
  • Target Sequence:

    TPQNITDLCAEYHNTQIYTLNDKIFSYTESLAGKREMAIITFKNGAIFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN
  • Tag:

    N-terminal 6xHis-tagged
  • Type:

    Developed Protein
  • Source:

    E.coli
  • Field of Research:

    Microbiology
  • Relevance:

    The B subunit pentameric ring directs the A subunit to its target by binding to the GM1 gangliosides present on the surface of the intestinal epithelial cells. It can bind five GM1 gangliosides. It has no toxic activity by itself.
  • Endotoxin:

    Not test
  • Purity:

    Greater than 90% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Function:

    The B subunit pentameric ring directs the A subunit to its target by binding to the GM1 gangliosides present on the surface of the intestinal epithelial cells. It can bind five GM1 gangliosides. It has no toxic activity by itself.
  • Molecular Weight:

    15.6 kDa
  • References & Citations:

    "Nucleotide sequence analysis of the A2 and B subunits of Vibrio cholerae enterotoxin." Lockman H., Kaper J.B. J. Biol. Chem. 258:13722-13726 (1983)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Full Length of Mature Protein