Recombinant Parietaria judaica Probable non-specific lipid-transfer protein 2

• Product Name Alternative:

  Allergen Par j II Major pollen allergen Par j 2.0101 Protein P2 Allergen: Par j 2.0101

• Abbreviation:

  Recombinant Parietaria judaica Probable non-specific lipid-transfer protein 2 protein

• UniProt:

  P55958

• Expression Region:

  32-133aa

• Organism:

  Parietaria judaica (Pellitory-of-the-wall) (Parietaria diffusa)

• Target Sequence:

  EEACGKVVQDIMPCLHFVKGEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVRATKGISGIKNELVAEVPKKCDIKTTLPPITADFDCSKIQSTIFRGYY

• Tag:

  N-terminal 6xHis-tagged

• Type:

  Developed Protein

• Source:

  Yeast

• Field of Research:

  Others

• Relevance:

  Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues.

• Endotoxin:

  Not test

• Purity:

  Greater than 90% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Function:

  Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues.

• Molecular Weight:

  13.3 kDa

• References & Citations:

  "Assignment of disulphide bridges in Par j 2.0101, a major allergen of Parietaria judaica pollen." Amoresano A., Pucci P., Duro G., Colombo P., Costa M.A., Izzo V., Lamba D., Geraci D. Biol. Chem. 384:1165-1172 (2003)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Full Length of Mature Protein