Recombinant Human Peroxisomal carnitine O-octanoyltransferase (CROT)

CAT:
399-CSB-EP891723HU-01
Size:
20 µg

For Laboratory Research Only. Not for Clinical or Personal Use.

  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Human Peroxisomal carnitine O-octanoyltransferase (CROT) - image 1

Recombinant Human Peroxisomal carnitine O-octanoyltransferase (CROT)

  • Product Name Alternative:

    Carnitine O octanoyltransferase; COT; CROT; OCTC_HUMAN; Peroxisomal carnitine acyltransferase; Peroxisomal carnitine O octanoyltransferase; Peroxisomal carnitine O-octanoyltransferase
  • Abbreviation:

    Recombinant Human CROT protein
  • Gene Name:

    CROT
  • UniProt:

    Q9UKG9
  • Expression Region:

    1-87aa
  • Organism:

    Homo sapiens (Human)
  • Target Sequence:

    MENQLAKSTEERTFQYQDSLPSLPVPSLEESLKKYLESVKPFANQEEYKKTEEIVQKFQSGIGEKLHQKLLERAKGKRNWVFVVIIE
  • Tag:

    N-terminal GST-tagged
  • Type:

    Developed Protein
  • Source:

    E.coli
  • Field of Research:

    Tags & Cell Markers
  • Relevance:

    Beta-oxidation of fatty acids. The highest activity concerns the C6 to C10 chain length substrate. Converts the end product of pristanic acid beta oxidation, 4,8-dimethylnonanoyl-CoA, to its corresponding carnitine ester.
  • Endotoxin:

    Not test
  • Purity:

    Greater than 90% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Function:

    Beta-oxidation of fatty acids. The highest activity concerns the C6 to C10 chain length substrate. Converts the end product of pristanic acid beta oxidation, 4,8-dimethylnonanoyl-CoA, to its corresponding carnitine ester.
  • Molecular Weight:

    37.2 kDa
  • References & Citations:

    "N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB." Van Damme P., Lasa M., Polevoda B., Gazquez C., Elosegui-Artola A., Kim D.S., De Juan-Pardo E., Demeyer K., Hole K., Larrea E., Timmerman E., Prieto J., Arnesen T., Sherman F., Gevaert K., Aldabe R. Proc. Natl. Acad. Sci. U.S.A. 109:12449-12454 (2012)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Full Length of Isoform 2