Recombinant Human Bcl-2-modifying factor (BMF)Recombinant Human Bcl-2-modifying factor (BMF) - High-quality laboratory reagent available from Gentaur. Catalog: 399-CSB-EP850383HU-01.399-CSB-EP850383HU-01399-CSB-EP850383HU-01Business & Industrial > Science & LaboratoryRecombinant Human Bcl-2-modifying factor (BMF)
Gentaur
EUR12027-02-22

Recombinant Human Bcl-2-modifying factor (BMF)

CAT:
399-CSB-EP850383HU-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Human Bcl-2-modifying factor (BMF) - image 1

Recombinant Human Bcl-2-modifying factor (BMF)

  • Product Name Alternative:

    Bcl 2 modifying factor; Bcl-2-modifying factor; Bcl2 modifying factor; Bmf; BMF_HUMAN; FLJ00065
  • Abbreviation:

    Recombinant Human BMF protein
  • Gene Name:

    BMF
  • UniProt:

    Q96LC9
  • Expression Region:

    1-184aa
  • Organism:

    Homo sapiens (Human)
  • Target Sequence:

    MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSPGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHQAEVQIARKLQCIADQFHRLHVQQHQQNQNRVWWQILLFLHNLALNGEENRNGAGPR
  • Tag:

    N-terminal GST-tagged
  • Type:

    Developed Protein
  • Source:

    E.coli
  • Field of Research:

    Cell Biology
  • Relevance:

    May play a role in apoptosis. Isoform 1 seems to be the main initiator.
  • Endotoxin:

    Not test
  • Purity:

    Greater than 90% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Function:

    May play a role in apoptosis. Isoform 1 seems to be the main initiator.
  • Molecular Weight:

    47.5 kDa
  • References & Citations:

    "Bmf: a proapoptotic BH3-only protein regulated by interaction with the myosin V actin motor complex, activated by anoikis." Puthalakath H., Villunger A., O'Reilly L.A., Beaumont J.G., Coultas L., Cheney R.E., Huang D.C.S., Strasser A. Science 293:1829-1832 (2001)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Full Length of BC069505