Recombinant Mouse Interleukin-1 family member 10 (Il1f10)

CAT:
399-CSB-EP837144MO-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Mouse Interleukin-1 family member 10 (Il1f10) - image 1

Recombinant Mouse Interleukin-1 family member 10 (Il1f10)

  • Product Name Alternative:

    Il1f10Interleukin-1 family member 10; IL-1F10
  • Abbreviation:

    Recombinant Mouse Il1f10 protein
  • Gene Name:

    Il1f10
  • UniProt:

    Q8R459
  • Expression Region:

    1-152aa
  • Organism:

    Mus musculus (Mouse)
  • Target Sequence:

    MCSLPMARYYIIKDAHQKALYTRNGQLLLGDPDSDNYSPEKVCILPNRGLDRSKVPIFLGMQGGSCCLACVKTREGPLLQLEDVNIEDLYKGGEQTTRFTFFQRSLGSAFRLEAAACPGWFLCGPAEPQQPVQLTKESEPSTHTEFYFEMSR
  • Tag:

    N-terminal 6xHis-SUMO-tagged
  • Type:

    In Stock Protein
  • Source:

    E.coli
  • Field of Research:

    Immunology
  • Relevance:

    Cytokine with immunomodulatory activity. Alone, does not induce cytokine production, but reduces IL22 and IL17A production by T-cells in response to heat-killed Candida albicans. Reduces IL36G-induced production of IL8 by peripheral blood mononuclear cells. Increases IL6 production by dendritic cells stimulated by bacterial lipopolysaccharides (LPS) . Ligand for IL-36R/IL1RL2 (By similarity) .
  • Endotoxin:

    Not test
  • Purity:

    Greater than 90% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Function:

    Cytokine with immunomodulatory activity. Alone, does not induce cytokine production, but reduces IL22 and IL17A production by T-cells in response to heat-killed Candida albicans. Reduces IL36G-induced production of IL8 by peripheral blood mononuclear cells. Increases IL6 production by dendritic cells stimulated by bacterial lipopolysaccharides (LPS) . Ligand for IL-36R/IL1RL2 (By similarity) .
  • Molecular Weight:

    33.1 kDa
  • References & Citations:

    "BGEM: an in situ hybridization database of gene expression in the embryonic and adult mouse nervous system."Magdaleno S., Jensen P., Brumwell C.L., Seal A., Lehman K., Asbury A., Cheung T., Cornelius T., Batten D.M., Eden C., Norland S.M., Rice D.S., Dosooye N., Shakya S., Mehta P., Curran T.PLoS Biol. 4:e86-e86 (2006)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Full Length